DC900408

Overview
NameDC900408
Unique NameDC900408
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length684
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4114 contig Csv1_Contig4114:85..768. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: ALEUL_ARATH (Thiol protease aleurain-like OS=Arabidopsis thaliana GN=At3g45310 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 5.235e-18
Identity = 51/132 (38.64%), Postives = 75/132 (56.82%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPV---DENQIAAHLVHHGPLAIGLNAIF-MQTYIGGVSCPLICGKKWL--NHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGMNT 435
            +YPY GK G C+F ++ I V+V +  NI +   DE + A  LV   P+++    +   + Y  GV     CG   +  NH VL VGYG +        + PYW+IKNSWG +WGD+GY+++  G+ MCG+ T
Sbjct:  228 AYPYTGKDGGCKFSAKNIGVQVRDSVNITLGAEDELKHAVGLVR--PVSVAFEVVHEFRFYKKGVFTSNTCGNTPMDVNHAVLAVGYGVED-------DVPYWLIKNSWGGEWGDNGYFKMEMGKNMCGVAT 350          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATL1_RAT (Cathepsin L1 OS=Rattus norvegicus GN=Ctsl1 PE=1 SV=2)

HSP 1 Score: 90.8929 bits (224), Expect = 6.836e-18
Identity = 46/129 (35.66%), Postives = 69/129 (53.49%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGMNT 435
            SYPY  K G C++ +E        F +IP  E  +   +   GP+++ ++A    +Q Y  G+     C  K L+HGVL+VGYG +G          YW++KNSWGK+WG  GY ++ + R   CG+ T
Sbjct:  201 SYPYEAKDGSCKYRAEYAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKDLDHGVLVVGYGYEGTDS---NKDKYWLVKNSWGKEWGMDGYIKIAKDRNNHCGLAT 326          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATV_NPVSE (Viral cathepsin OS=Spodoptera exigua nuclear polyhedrosis virus (strain US) GN=VCATH PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.166e-17
Identity = 49/124 (39.52%), Postives = 67/124 (54.03%), Query Frame = 1
Query:   61 YPYIGKRGKCQFDSEKIAVRVAN-FTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            Y Y  +R  C     K A  V N +  + ++E ++   L + GP+AI ++A+ +  Y GG+     C    LNH VLLVGYG +        N PYWIIKNSWG  +G+ GY R+ RG   CGM
Sbjct:  212 YSYKAERQPCALKPHKFATGVRNCYRYVILNEERLEDLLRYVGPIAIAVDAVDLTDYYGGIVS--FCENNGLNHAVLLVGYGVEN-------NVPYWIIKNSWGSDYGEDGYVRVRRGVNSCGM 326          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATL1_MOUSE (Cathepsin L1 OS=Mus musculus GN=Ctsl1 PE=1 SV=2)

HSP 1 Score: 90.1225 bits (222), Expect = 1.166e-17
Identity = 46/129 (35.66%), Postives = 68/129 (52.71%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGMNT 435
            SYPY  K G C++ +E        F +IP  E  +   +   GP+++ ++A    +Q Y  G+     C  K L+HGVLLVGYG +G          YW++KNSWG +WG  GY ++ + R   CG+ T
Sbjct:  201 SYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDS---NKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLAT 326          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATH_RAT (Cathepsin H OS=Rattus norvegicus GN=Ctsh PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.166e-17
Identity = 51/129 (39.53%), Postives = 70/129 (54.26%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAI--FMQTYIGGVSCPLICGKK--WLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            SYPYIGK G+C+F+ EK    V N  NI + DE  +   +  + P++        FM  Y  GV     C K    +NH VL VGYG +   +       YWI+KNSWG  WG++GY+ + RG+ MCG+
Sbjct:  202 SYPYIGKNGQCKFNPEKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFMM-YKSGVYSSNSCHKTPDKVNHAVLAVGYGEQNGLL-------YWIVKNSWGSNWGNNGYFLIERGKNMCGL 322          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATJ_MOUSE (Cathepsin J OS=Mus musculus GN=Ctsj PE=2 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 1.523e-17
Identity = 44/131 (33.59%), Postives = 79/131 (60.31%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRG-RGMCGMNTM 438
            ++YPY GK G C++ SE  +  + ++ N+P +E  +   +   GP++  ++A     + Y GG+     C   ++NH VL+VGYG++G   ++ GN  YW+IKNSWG++WG +GY ++ +     CG+ ++
Sbjct:  200 ATYPYEGKDGPCRYRSENASANITDYVNLPPNELYLWVAVASIGPVSAAIDASHDSFRFYNGGIYYEPNCSSYFVNHAVLVVGYGSEG--DVKDGNN-YWLIKNSWGEEWGMNGYMQIAKDHNNHCGIASL 327          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: TEST2_MOUSE (Testin-2 OS=Mus musculus PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.598e-17
Identity = 49/139 (35.25%), Postives = 74/139 (53.24%), Query Frame = 1
Query:   31 IATEG*XXSSYPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRG-RGMCGMNTM 438
            +ATE     SYPYIG   KC++ +E  A  V +F  IP  E  +   +   GP+++ ++A     Q Y  G+     C +  LNH VL+VGYG +G          YW++KNSWG++WG  GY ++ +     CG+ T+
Sbjct:  196 LATE----ESYPYIGPGRKCRYHAENSAANVRDFVQIPGREEALMKAVAKVGPISVAVDASHDSFQFYDSGIYYEPQCKRVHLNHAVLVVGYGFEG---EESDGNSYWLVKNSWGEEWGMKGYIKIAKDWNNHCGIATL 327          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CYSP2_MAIZE (Cysteine proteinase 2 OS=Zea mays GN=CCP2 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.598e-17
Identity = 52/132 (39.39%), Postives = 71/132 (53.79%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPV---DENQIAAHLVHHGPLAIGLNAIF-MQTYIGGVSCPLICGKKWL--NHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGMNT 435
            SYPY G  G C+F +E + V+V +  NI +   DE + A  LV   P+++    I   + Y  GV     CG   +  NH VL VGYG +          PYW+IKNSWG  WGD GY+++  G+ MCG+ T
Sbjct:  230 SYPYQGVNGICKFKNENVGVKVLDSVNITLGAEDELKDAVGLVR--PVSVAFEVITGFRLYKSGVYTSDHCGTTPMDVNHAVLAVGYGVED-------GVPYWLIKNSWGADWGDEGYFKMEMGKNMCGVAT 352          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CYSP2_LEIPI (Cysteine proteinase 2 OS=Leishmania pifanoi GN=CYS2 PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 4.431e-17
Identity = 52/127 (40.94%), Postives = 66/127 (51.97%), Query Frame = 1
Query:   58 SYPYIGKRG---KCQFDSEKIAV--RVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMC 423
            SYPY+   G   +C   SE++ V  ++     I   E  +AA L  +GP+AI L+A    +Y  GV     C  K LNHGVLLVGY   G         PYW+IKNSWG  WG+ GY R+  G   C
Sbjct:  213 SYPYVSGNGYVPECSNSSEELVVGAQIDGHVLIGSSEKAMAAWLAKNGPIAIALDASSFMSYKSGVLTA--CIGKQLNHGVLLVGYDMTG-------EVPYWVIKNSWGGDWGEQGYVRVVMGVNAC 330          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CYSP3_SOLLC (Cysteine proteinase 3 OS=Solanum lycopersicum GN=CYP-3 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 7.559e-17
Identity = 51/131 (38.93%), Postives = 68/131 (51.91%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPVD---ENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWL--NHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGMNT 435
            +YPY GK G C+F    I V+V +  NI +    E + A  LV    +A  +   F Q Y  GV     CG   +  NH VL VGYG +          PYW+IKNSWG  WG+ GY+++  G+ MCG+ T
Sbjct:  226 AYPYTGKNGICKFSQANIGVKVISSVNITLGAEYELKYAVALVRPVSVAFEVVKGFKQ-YKSGVYASTECGDTPMDVNHAVLAVGYGVEN-------GTPYWLIKNSWGADWGEDGYFKMEMGKNMCGVAT 348          
The following BLAST results are available for this feature:
BLAST of DC900408 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 119
Match NameE-valueIdentityDescription
ALEUL_ARATH5.235e-1838.64Thiol protease aleurain-like OS=Arabidopsis thalia... [more]
CATL1_RAT6.836e-1835.66Cathepsin L1 OS=Rattus norvegicus GN=Ctsl1 PE=1 SV... [more]
CATV_NPVSE1.166e-1739.52Viral cathepsin OS=Spodoptera exigua nuclear polyh... [more]
CATL1_MOUSE1.166e-1735.66Cathepsin L1 OS=Mus musculus GN=Ctsl1 PE=1 SV=2[more]
CATH_RAT1.166e-1739.53Cathepsin H OS=Rattus norvegicus GN=Ctsh PE=1 SV=1[more]
CATJ_MOUSE1.523e-1733.59Cathepsin J OS=Mus musculus GN=Ctsj PE=2 SV=2[more]
TEST2_MOUSE2.598e-1735.25Testin-2 OS=Mus musculus PE=2 SV=1[more]
CYSP2_MAIZE2.598e-1739.39Cysteine proteinase 2 OS=Zea mays GN=CCP2 PE=2 SV=... [more]
CYSP2_LEIPI4.431e-1740.94Cysteine proteinase 2 OS=Leishmania pifanoi GN=CYS... [more]
CYSP3_SOLLC7.559e-1738.93Cysteine proteinase 3 OS=Solanum lycopersicum GN=C... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900408 VSS Citrus sinensis cDNA clone VS28985 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900408 ID=DC900408|Name=DC900408|organism=Citrus sinensis|type=EST|length=684bp
TGAGGCCTCATGACAATGCATCCAATATTGATCGCGACTGAGGGCTAAAN
AGANAGTTCATATCCTTATATTGGGAAGCGTGGCAAATGCCAATTCGATT
CAGAGAAAATAGCCGTTCGAGTTGCAAATTTTACCAATATTCCTGTCGAT
GAGAACCAAATTGCTGCACATTTAGTCCACCACGGTCCTCTGGCTATTGG
GTTGAACGCTATATTCATGCAAACATACATTGGGGGAGTCTCATGCCCGC
TAATCTGCGGCAAGAAATGGCTCAACCACGGCGTTCTGCTCGTCGGGTAT
GGTGCCAAGGGCTTCTCAATTCTTAGGCTTGGAAACCAGCCGTATTGGAT
CATCAAGAATTCGTGGGGCAAGCAATGGGGAGACCATGGGTACTACCGGC
TCTGCCGAGGGCGTGGCATGTGTGGAATGAACACCATGGTTTCTGCAGTG
GTCACTCAAGTCTCCTCCTAAACTTGAAGTCCCTCTTATTAAGTTGGAAT
ATCTACAGAAAGCAATATAGACAGCTCATGTTATATGGTAGCTAGTTTCC
CTTTTGTTCTTGTTTGTGATCTTCTAATTATTGAAGCTTTTCCGGTTTCA
TAATTCCCCTTTCTCAAGTAAGTTCTGGATTAGACTTGAAAATGCTTTTC
AGACCTGCTCTTCTACATACTATTGTGTCTTCCA
back to top