DC900408

Overview
NameDC900408
Unique NameDC900408
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length684
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4114 contig Csv1_Contig4114:85..768. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATL1_FELCA (Cathepsin L1 (Fragment) OS=Felis catus GN=CTSL1 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.899e-16
Identity = 43/121 (35.54%), Postives = 65/121 (53.72%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR 414
            SYPY  +   C++  E     V ++ +IP  EN++   L   GP++  ++A     + Y  G+     C  + ++HGVL+VGYGA G       N+ YWIIKNSWG  WG  GY ++ + R
Sbjct:   22 SYPYHAQGDSCKYRPENSVANVTDYWDIPSKENELMITLAAVGPISAAIDASLDTFRFYKEGIYYDPSCSSEDVDHGVLVVGYGADG---TETENKKYWIIKNSWGTDWGMDGYIKMAKDR 139          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: TEST2_RAT (Testin-2 OS=Rattus norvegicus GN=Testin PE=1 SV=2)

HSP 1 Score: 83.9593 bits (206), Expect = 8.357e-16
Identity = 47/138 (34.06%), Postives = 73/138 (52.90%), Query Frame = 1
Query:   31 IATEG*XXSSYPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRG-RGMCGMNT 435
            +ATE     SYPY G+  +C++ +E  A  V +F  IP  E  +   +   GP+++ ++A     Q Y  G+     C +  LNH VL+VGYG +G          +W++KNSWG++WG  GY +L +     CG+ T
Sbjct:  196 LATE----ESYPYRGQGRECRYHAENSAANVRDFVQIPGSEEALMKAVAKVGPISVAVDASHGSFQFYGSGIYYEPQCKRVHLNHAVLVVGYGFEG---EESDGNSFWLVKNSWGEEWGMKGYMKLAKDWSNHCGIAT 326          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATS_SAIBB (Cathepsin S OS=Saimiri boliviensis boliviensis GN=CTSS PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 8.357e-16
Identity = 45/129 (34.88%), Postives = 71/129 (55.04%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLV-HHGPLAIGLNAIFMQTYI--GGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRG-MCGM 429
            +SYPY     KCQ+DS+  A   + +T +P     +    V + GP+ +G++A     ++   GV     C +K +NHGVL++GYG        L  + YW++KNSWG  +G+ GY R+ R +G  CG+
Sbjct:  201 ASYPYKATDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVCVGVDASHPSFFLYRSGVYYDPACTQK-VNHGVLVIGYGD-------LNGKEYWLVKNSWGSNFGEQGYIRMARNKGNHCGI 321          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATV_GVCP (Viral cathepsin OS=Cydia pomonella granulosis virus GN=VCATH PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.425e-15
Identity = 44/123 (35.77%), Postives = 71/123 (57.72%), Query Frame = 1
Query:   64 PYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLIC-GKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            PY G  G C+    ++++  +    +  +EN++   LV +GP+++ ++   +  Y  G++   IC   + LNH VLLVGYG K        + PYWI+KNSWG +WG+ GY+R+ R +  CGM
Sbjct:  211 PYYGFDGVCKKSPFELSISGSR-RYVLQNENKLRELLVVNGPISVAIDVSDLINYKAGIAD--ICENNEGLNHAVLLVGYGVKN-------DVPYWILKNSWGAEWGEEGYFRVQRDKNSCGM 323          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATH_HUMAN (Cathepsin H OS=Homo sapiens GN=CTSH PE=1 SV=4)

HSP 1 Score: 83.1889 bits (204), Expect = 1.425e-15
Identity = 49/129 (37.98%), Postives = 66/129 (51.16%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAI--FMQTYIGGVSCPLICGKK--WLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            +YPY GK G C+F   K    V +  NI + DE  +   +  + P++        FM  Y  G+     C K    +NH VL VGYG K          PYWI+KNSWG QWG +GY+ + RG+ MCG+
Sbjct:  204 TYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMM-YRTGIYSSTSCHKTPDKVNHAVLAVGYGEKN-------GIPYWIVKNSWGPQWGMNGYFLIERGKNMCGL 324          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATL1_SHEEP (Cathepsin L1 OS=Ovis aries GN=CTSL PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.862e-15
Identity = 44/129 (34.11%), Postives = 67/129 (51.94%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNA--IFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGMNT 435
            SYPY      C +  E  A +   F +IP  E  +   +   GP+++ ++A     Q Y  G+     C  K L+HGVL+VGYG +G       N  +WI+KNSWG +WG+ GY ++ + +   CG+ T
Sbjct:   88 SYPYEATDTSCNYKPEYSAAKDTGFVDIPQREKALMKAVATVGPISVAIDAGHSSFQFYKSGIYYDPDCSSKDLDHGVLVVGYGFEGT------NNKFWIVKNSWGPEWGNKGYVKMAKDQNNHCGIAT 210          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATO_MOUSE (Cathepsin O OS=Mus musculus GN=Ctso PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.432e-15
Identity = 44/128 (34.38%), Postives = 68/128 (53.12%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQ-FDSEKIAVRVANFT--NIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            S YP+    G+C+ F   +  V V +F+  N    E+++A  L+  GPL + ++A+  Q Y+GG+     C     NH VL+ G+        R GN PYW+++NSWG  WG  GY  +  G  +CG+
Sbjct:  184 SQYPFKAVNGQCRHFPQSQAGVSVKDFSAYNFRGQEDEMARALLSFGPLVVIVDAMSWQDYLGGI-IQHHCSSGEANHAVLITGFD-------RTGNTPYWMVRNSWGSSWGVEGYAHVKMGGNVCGI 303          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATL1_PIG (Cathepsin L1 OS=Sus scrofa GN=CTSL1 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.176e-15
Identity = 44/130 (33.85%), Postives = 70/130 (53.85%), Query Frame = 1
Query:   58 SYPYIGKR-GKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNA--IFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGMNT 435
            SYPY+G+    C +  E  A     F +IP  E  +   +   GP+++ ++A     Q Y  G+     C  K L+HGVL+VGYG +G       +  +WI+KNSWG +WG +GY ++ + +   CG++T
Sbjct:  201 SYPYLGRETNSCTYKPECSAANDTGFVDIPQREKALMKAVATVGPISVAIDAGHSSFQFYKSGIYYDPDCSSKDLDHGVLVVGYGFEGTDS---NSSKFWIVKNSWGPEWGWNGYVKMAKDQNNHCGIST 327          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CYSP3_HOMAM (Digestive cysteine proteinase 3 OS=Homarus americanus GN=LCP3 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.148e-15
Identity = 43/128 (33.59%), Postives = 63/128 (49.22%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNA--IFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGM 429
            SSYPY  +   C+FD+  I         +   E  +   +   GP+++ ++A     Q Y  GV     C   +L+HGVL VGYG +         + YW++KNSWG  WGD GY ++ R R   CG+
Sbjct:  192 SSYPYEAEDRSCRFDANSIGAICTGSVEVQHTEEALQEAVSGVGPISVAIDASHFSFQFYSSGVYYEQNCSPTFLDHGVLAVGYGTES-------TKDYWLVKNSWGSSWGDAGYIKMSRNRDNNCGI 312          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATS_HUMAN (Cathepsin S OS=Homo sapiens GN=CTSS PE=1 SV=3)

HSP 1 Score: 81.6481 bits (200), Expect = 4.148e-15
Identity = 45/129 (34.88%), Postives = 71/129 (55.04%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLV-HHGPLAIGLNAIFMQTYI--GGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRG-MCGM 429
            +SYPY     KCQ+DS+  A   + +T +P     +    V + GP+++G++A     ++   GV     C +  +NHGVL+VGYG        L  + YW++KNSWG  +G+ GY R+ R +G  CG+
Sbjct:  202 ASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQN-VNHGVLVVGYGD-------LNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGI 322          
The following BLAST results are available for this feature:
BLAST of DC900408 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 119
Match NameE-valueIdentityDescription
CATL1_FELCA4.899e-1635.54Cathepsin L1 (Fragment) OS=Felis catus GN=CTSL1 PE... [more]
TEST2_RAT8.357e-1634.06Testin-2 OS=Rattus norvegicus GN=Testin PE=1 SV=2[more]
CATS_SAIBB8.357e-1634.88Cathepsin S OS=Saimiri boliviensis boliviensis GN=... [more]
CATV_GVCP1.425e-1535.77Viral cathepsin OS=Cydia pomonella granulosis viru... [more]
CATH_HUMAN1.425e-1537.98Cathepsin H OS=Homo sapiens GN=CTSH PE=1 SV=4[more]
CATL1_SHEEP1.862e-1534.11Cathepsin L1 OS=Ovis aries GN=CTSL PE=1 SV=1[more]
CATO_MOUSE2.432e-1534.38Cathepsin O OS=Mus musculus GN=Ctso PE=2 SV=1[more]
CATL1_PIG3.176e-1533.85Cathepsin L1 OS=Sus scrofa GN=CTSL1 PE=2 SV=1[more]
CYSP3_HOMAM4.148e-1533.59Digestive cysteine proteinase 3 OS=Homarus america... [more]
CATS_HUMAN4.148e-1534.88Cathepsin S OS=Homo sapiens GN=CTSS PE=1 SV=3[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900408 VSS Citrus sinensis cDNA clone VS28985 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900408 ID=DC900408|Name=DC900408|organism=Citrus sinensis|type=EST|length=684bp
TGAGGCCTCATGACAATGCATCCAATATTGATCGCGACTGAGGGCTAAAN
AGANAGTTCATATCCTTATATTGGGAAGCGTGGCAAATGCCAATTCGATT
CAGAGAAAATAGCCGTTCGAGTTGCAAATTTTACCAATATTCCTGTCGAT
GAGAACCAAATTGCTGCACATTTAGTCCACCACGGTCCTCTGGCTATTGG
GTTGAACGCTATATTCATGCAAACATACATTGGGGGAGTCTCATGCCCGC
TAATCTGCGGCAAGAAATGGCTCAACCACGGCGTTCTGCTCGTCGGGTAT
GGTGCCAAGGGCTTCTCAATTCTTAGGCTTGGAAACCAGCCGTATTGGAT
CATCAAGAATTCGTGGGGCAAGCAATGGGGAGACCATGGGTACTACCGGC
TCTGCCGAGGGCGTGGCATGTGTGGAATGAACACCATGGTTTCTGCAGTG
GTCACTCAAGTCTCCTCCTAAACTTGAAGTCCCTCTTATTAAGTTGGAAT
ATCTACAGAAAGCAATATAGACAGCTCATGTTATATGGTAGCTAGTTTCC
CTTTTGTTCTTGTTTGTGATCTTCTAATTATTGAAGCTTTTCCGGTTTCA
TAATTCCCCTTTCTCAAGTAAGTTCTGGATTAGACTTGAAAATGCTTTTC
AGACCTGCTCTTCTACATACTATTGTGTCTTCCA
back to top