DC900408

Overview
NameDC900408
Unique NameDC900408
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length684
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4114 contig Csv1_Contig4114:85..768. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATL2_BOVIN (Cathepsin L2 OS=Bos taurus GN=CTSL2 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.576e-14
Identity = 44/130 (33.85%), Postives = 67/130 (51.54%), Query Frame = 1
Query:   58 SYPYIGK-RGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNA--IFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGMNT 435
            SYPY+      C +  E  A     F +IP  E  +   +   GP+++ ++A     Q Y  G+     C  K L+HGVL+VGYG +G       N  +WI+KNSWG +WG +GY ++ + +   CG+ T
Sbjct:  201 SYPYLATDTNSCNYKPECSAANDTGFVDIPQREKALMKAVATVGPISVAIDAGHTSFQFYKSGIYYDPDCSSKDLDHGVLVVGYGFEGTDS---NNNKFWIVKNSWGPEWGWNGYVKMAKDQNNHCGIAT 327          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATL1_BOVIN (Cathepsin L1 OS=Bos taurus GN=CTSL1 PE=1 SV=3)

HSP 1 Score: 79.7221 bits (195), Expect = 1.576e-14
Identity = 44/130 (33.85%), Postives = 67/130 (51.54%), Query Frame = 1
Query:   58 SYPYIGK-RGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNA--IFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGMNT 435
            SYPY+      C +  E  A     F +IP  E  +   +   GP+++ ++A     Q Y  G+     C  K L+HGVL+VGYG +G       N  +WI+KNSWG +WG +GY ++ + +   CG+ T
Sbjct:  201 SYPYLATDTNSCNYKPECSAANDTGFVDIPQREKALMKAVATVGPISVAIDAGHTSFQFYKSGIYYDPDCSSKDLDHGVLVVGYGFEGTDS---NNNKFWIVKNSWGPEWGWNGYVKMAKDQNNHCGIAT 327          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATK_MOUSE (Cathepsin K OS=Mus musculus GN=Ctsk PE=2 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 1.576e-14
Identity = 44/131 (33.59%), Postives = 69/131 (52.67%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGMNTM 438
            +YPY+G+   C +++   A +   +  IPV +E  +   +   GP+++ ++A     Q Y  GV     C +  +NH VL+VGYG +  S        +WIIKNSWG+ WG+ GY  L R +   CG+  M
Sbjct:  200 AYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVARVGPISVSIDASLASFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGS-------KHWIIKNSWGESWGNKGYALLARNKNNACGITNM 323          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATV_NPVEP (Viral cathepsin OS=Epiphyas postvittana nucleopolyhedrovirus GN=VCATH PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.688e-14
Identity = 42/126 (33.33%), Postives = 62/126 (49.21%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVANFTN-IPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            + YPY      C+ D  K  V V      I + E ++   L   GP+ + ++A  +  Y  G+     C    LNH VLLVGYG +        N PYWI+KNSWG  WG+ G++++ +    CG+
Sbjct:  196 NDYPYESSNNYCRMDPTKFVVGVKQCNRYITIYEEKLKDVLRLAGPIPVAIDASDILNYEQGII--KYCANNGLNHAVLLVGYGVEN-------NVPYWILKNSWGTDWGEQGFFKIQQNVNACGI 312          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATV_NPVCF (Viral cathepsin OS=Choristoneura fumiferana nuclear polyhedrosis virus GN=Vcath PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.688e-14
Identity = 42/126 (33.33%), Postives = 64/126 (50.79%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVAN-FTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            S YPY    G C+ ++ K  V+V   +  I V E ++   L   GP+ + ++A  +  Y  G+     C    LNH VLLVGY  +          P+WI+KN+WG  WG+ GY+R+ +    CG+
Sbjct:  197 SDYPYEANNGDCRANAAKFVVKVKKCYRYITVFEEKLKDLLRSVGPIPVAIDASDIVNYKRGIM--KYCANHGLNHAVLLVGYAVEN-------GVPFWILKNTWGADWGEQGYFRVQQNINACGI 313          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATV_NPVAC (Viral cathepsin OS=Autographa californica nuclear polyhedrosis virus GN=VCATH PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.688e-14
Identity = 44/126 (34.92%), Postives = 64/126 (50.79%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVAN-FTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            S YPY      C+ +S K  V+V + +  I V E ++   L   GP+ + ++A  +  Y  G+     C    LNH VLLVGYG +        N PYW  KN+WG  WG+ G++R+ +    CGM
Sbjct:  196 SDYPYEADNNNCRMNSNKFLVQVKDCYRYITVYEEKLKDLLRLVGPIPMAIDAADIVNYKQGII--KYCFNSGLNHAVLLVGYGVEN-------NIPYWTFKNTWGTDWGEDGFFRVQQNINACGM 312          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CYSP5_DICDI (Cysteine proteinase 5 OS=Dictyostelium discoideum GN=cprE PE=2 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 3.511e-14
Identity = 43/140 (30.71%), Postives = 66/140 (47.14%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFM--QTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFS------------ILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGM 429
            SSYPY  + GKC++ SE     ++++  +           V+  P+++ ++A     Q Y  G+     C  + L+HGVL VGYG+   S            +    +  YWI+KNSWG  WG  GY  + R R   CG+
Sbjct:  196 SSYPYKAENGKCEYKSENSGATLSSYKTVTAGSESSLESAVNVNPVSVAIDASHQSFQLYTSGIYYEPECSSENLDHGVLAVGYGSGSGSSSGQSSGQSSGNLSASSSNEYWIVKNSWGTSWGIEGYILMSRNRDNNCGI 335          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CYSP1_HOMAM (Digestive cysteine proteinase 1 OS=Homarus americanus GN=LCP1 PE=1 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 3.511e-14
Identity = 43/131 (32.82%), Postives = 65/131 (49.62%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGMNT 435
            SSYPY  +   C+F+S  I      +  I    E+ +       GP+++ ++A     Q+Y  GV     C    L+H VL VGYG++G        Q +W++KNSW   WG+ GY ++ R R   CG+ T
Sbjct:  192 SSYPYEARDNTCRFNSNTIGATCTGYVGIAQGSESALKTATRDIGPISVAIDASHRSFQSYYTGVYYEPSCSSSQLDHAVLAVGYGSEG-------GQDFWLVKNSWATSWGESGYIKMARNRNNNCGIAT 315          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATL1_CHICK (Cathepsin L1 (Fragments) OS=Gallus gallus GN=CTSL1 PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.511e-14
Identity = 46/131 (35.11%), Postives = 70/131 (53.44%), Query Frame = 1
Query:   58 SYPYIGKRGK-CQFDSEKIAVRVANFTNIPVD-ENQIAAHLVHHGPLAIGLNA--IFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGMNT 435
            SYPY  K  + C++ +E  A     F +IP   E  +   +   GP+++ ++A     Q Y  G+     C  + L+HGVL+VGYG +G        + YWI+KNSWG++WGD GY  + + R   CG+ T
Sbjct:   88 SYPYTAKDDEDCRYKAEYNAANDTGFVDIPQGHERALMKAVASVGPVSVAIDAGHSSFQFYQSGIYYEPDCSSEDLDHGVLVVGYGFEG-------GKKYWIVKNSWGEKWGDKGYIYMAKDRKNHCGIAT 211          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATK_CHICK (Cathepsin K OS=Gallus gallus GN=CTSK PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.511e-14
Identity = 45/128 (35.16%), Postives = 65/128 (50.78%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPVD-ENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRG-RGMCGM 429
            +YPYIG+   C +     A +   +  IP D E  +   +   GP+++G++A     Q Y  GV     C  + +NH VL VGYGA+           +WIIKNSWG +WG+ GY  L R  +  CG+
Sbjct:  205 AYPYIGQDESCMYSPTGKAAKCRGYREIPEDNEKALKRAVARIGPVSVGIDASLPSFQFYSRGVYYDTGCNPENINHAVLAVGYGAQK-------GTKHWIIKNSWGTEWGNKGYVLLARNMKQTCGI 325          
The following BLAST results are available for this feature:
BLAST of DC900408 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 119
Match NameE-valueIdentityDescription
CATL2_BOVIN1.576e-1433.85Cathepsin L2 OS=Bos taurus GN=CTSL2 PE=2 SV=1[more]
CATL1_BOVIN1.576e-1433.85Cathepsin L1 OS=Bos taurus GN=CTSL1 PE=1 SV=3[more]
CATK_MOUSE1.576e-1433.59Cathepsin K OS=Mus musculus GN=Ctsk PE=2 SV=2[more]
CATV_NPVEP2.688e-1433.33Viral cathepsin OS=Epiphyas postvittana nucleopoly... [more]
CATV_NPVCF2.688e-1433.33Viral cathepsin OS=Choristoneura fumiferana nuclea... [more]
CATV_NPVAC2.688e-1434.92Viral cathepsin OS=Autographa californica nuclear ... [more]
CYSP5_DICDI3.511e-1430.71Cysteine proteinase 5 OS=Dictyostelium discoideum ... [more]
CYSP1_HOMAM3.511e-1432.82Digestive cysteine proteinase 1 OS=Homarus america... [more]
CATL1_CHICK3.511e-1435.11Cathepsin L1 (Fragments) OS=Gallus gallus GN=CTSL1... [more]
CATK_CHICK3.511e-1435.16Cathepsin K OS=Gallus gallus GN=CTSK PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900408 VSS Citrus sinensis cDNA clone VS28985 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900408 ID=DC900408|Name=DC900408|organism=Citrus sinensis|type=EST|length=684bp
TGAGGCCTCATGACAATGCATCCAATATTGATCGCGACTGAGGGCTAAAN
AGANAGTTCATATCCTTATATTGGGAAGCGTGGCAAATGCCAATTCGATT
CAGAGAAAATAGCCGTTCGAGTTGCAAATTTTACCAATATTCCTGTCGAT
GAGAACCAAATTGCTGCACATTTAGTCCACCACGGTCCTCTGGCTATTGG
GTTGAACGCTATATTCATGCAAACATACATTGGGGGAGTCTCATGCCCGC
TAATCTGCGGCAAGAAATGGCTCAACCACGGCGTTCTGCTCGTCGGGTAT
GGTGCCAAGGGCTTCTCAATTCTTAGGCTTGGAAACCAGCCGTATTGGAT
CATCAAGAATTCGTGGGGCAAGCAATGGGGAGACCATGGGTACTACCGGC
TCTGCCGAGGGCGTGGCATGTGTGGAATGAACACCATGGTTTCTGCAGTG
GTCACTCAAGTCTCCTCCTAAACTTGAAGTCCCTCTTATTAAGTTGGAAT
ATCTACAGAAAGCAATATAGACAGCTCATGTTATATGGTAGCTAGTTTCC
CTTTTGTTCTTGTTTGTGATCTTCTAATTATTGAAGCTTTTCCGGTTTCA
TAATTCCCCTTTCTCAAGTAAGTTCTGGATTAGACTTGAAAATGCTTTTC
AGACCTGCTCTTCTACATACTATTGTGTCTTCCA
back to top