DC900408

Overview
NameDC900408
Unique NameDC900408
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length684
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4114 contig Csv1_Contig4114:85..768. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATH_PIG (Cathepsin H OS=Sus scrofa GN=CTSH PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.511e-14
Identity = 45/129 (34.88%), Postives = 66/129 (51.16%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAI--FMQTYIGGVSCPLICGKK--WLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            +YPY G+   C+F  +K    V +  NI + DE  +   +  + P++        F+  Y  G+     C K    +NH VL VGYG +          PYWI+KNSWG QWG +GY+ + RG+ MCG+
Sbjct:  204 TYPYKGQDDHCKFQPDKAIAFVKDVANITMNDEEAMVEAVALYNPVSFAFEVTNDFLM-YRKGIYSSTSCHKTPDKVNHAVLAVGYGEEN-------GIPYWIVKNSWGPQWGMNGYFLIERGKNMCGL 324          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATV_NPVRO (Viral cathepsin OS=Rachiplusia ou multiple nucleopolyhedrovirus GN=VCATH PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.586e-14
Identity = 43/126 (34.13%), Postives = 64/126 (50.79%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVAN-FTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            S YPY      C+ ++ K  V+V + +  I V E ++   L   GP+ + ++A  +  Y  G+     C    LNH VLLVGYG +        N PYW  KN+WG  WG+ G++R+ +    CGM
Sbjct:  196 SDYPYEADNNNCRMNTNKFLVQVKDCYRYITVYEEKLKDLLRLVGPIPMAIDAADIVNYKQGII--KYCFNSGLNHAVLLVGYGVEN-------NIPYWTFKNTWGTDWGEEGFFRVQQNINACGM 312          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATV_NPVBM (Viral cathepsin OS=Bombyx mori nuclear polyhedrosis virus GN=VCATH PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.586e-14
Identity = 44/126 (34.92%), Postives = 64/126 (50.79%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVAN-FTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            S YPY      C+ +S K  V+V + +  I V E ++   L   GP+ + ++A  +  Y  G+     C    LNH VLLVGYG +        N PYW  KN+WG  WG+ G++R+ +    CGM
Sbjct:  196 SDYPYEADNNNCRMNSNKFLVQVKDCYRYIIVYEEKLKDLLPLVGPIPMAIDAADIVNYKQGII--KYCFDSGLNHAVLLVGYGVEN-------NIPYWTFKNTWGTDWGEDGFFRVQQNINACGM 312          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATL1_CERAE (Cathepsin L1 OS=Cercopithecus aethiops GN=CTSL1 PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.586e-14
Identity = 42/128 (32.81%), Postives = 66/128 (51.56%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNA---IFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRG-RGMCGM 429
            SYPY      C+++ E        F +IP  E  +   +   GP+++ ++A    FM  Y  G+     C  + ++HGVL+VGYG   F      N  YW++KNSWG++WG  GY ++ +  R  CG+
Sbjct:  201 SYPYEATEESCKYNPEYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFM-FYKEGIYFEPDCSSEDMDHGVLVVGYG---FESTESDNSKYWLVKNSWGEEWGMGGYIKMAKDRRNHCGI 324          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATLL_PHACE (Cathepsin L-like proteinase OS=Phaedon cochleariae PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 7.822e-14
Identity = 44/130 (33.85%), Postives = 64/130 (49.23%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQF-DSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRG-MCGMNTM 438
            + YPY GK  KC+  D  +  V +  +  +   E  +   +   GP++  +    M++Y GG+     C    L+HGV +VGYG +         Q YWIIKN+WG  WG+ GY RL R     CG+  M
Sbjct:  195 ADYPYSGKEDKCKANDKSRSVVELTGYKKVTASETSLKEAVGTIGPISAVVFGKPMKSYGGGIFDDSSCLGDNLHHGVNVVGYGIEN-------GQKYWIIKNTWGADWGESGYIRLIRDTDHSCGVEKM 317          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATV_NPVAP (Viral cathepsin OS=Antheraea pernyi nuclear polyhedrosis virus GN=VCATH PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.022e-13
Identity = 41/126 (32.54%), Postives = 65/126 (51.59%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVAN-FTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            + YPY    G C+ ++ K  VRV   +  + + E ++   L   GP+ + ++A  +  Y  G+     C    LNH VLLVGYG +          P+WI+KN+WG  WG+ GY+R+ +    CG+
Sbjct:  197 NDYPYEANNGPCRVNAAKFVVRVKKCYRYVTLFEEKLKDLLRIVGPIPVAIDASDIVGYKRGII--RYCENHGLNHAVLLVGYGVEN-------GIPFWILKNTWGADWGEQGYFRVQQNINACGI 313          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATL_DROME (Cathepsin L OS=Drosophila melanogaster GN=Cp1 PE=1 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 1.022e-13
Identity = 43/128 (33.59%), Postives = 66/128 (51.56%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGM 429
            SYPY      C F+   +      FT+IP  DE ++A  +   GP+++ ++A     Q Y  GV     C  + L+HGVL+VG+G           + YW++KNSWG  WGD G+ ++ R +   CG+
Sbjct:  241 SYPYEAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTDE------SGEDYWLVKNSWGTTWGDKGFIKMLRNKENQCGI 362          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATS_MOUSE (Cathepsin S OS=Mus musculus GN=Ctss PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.334e-13
Identity = 43/130 (33.08%), Postives = 68/130 (52.31%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAIFMQTYI---GGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCR-GRGMCGM 429
            +SYPY     KC ++S+  A   + +  +P  DE+ +   +   GP+++G++A     +    G    P   G   +NHGVL+VGYG        L  + YW++KNSWG  +GD GY R+ R  +  CG+
Sbjct:  211 ASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGN--VNHGVLVVGYGT-------LDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGI 331          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATV_NPVOP (Viral cathepsin OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=VCATH PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.743e-13
Identity = 42/126 (33.33%), Postives = 64/126 (50.79%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVANFTN-IPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            S YPY    G+C+ +  +  V V +    I + E ++   L   GP+ + ++A  +  Y  G+     C    LNH VLLVGY  +        N PYWI+KN+WG  WG+ GY+R+ +    CG+
Sbjct:  197 SDYPYETANGQCRINPNRFVVGVRSCRRYIVMFEEKLKDLLRAVGPIPVAIDASDIVNYRRGIMRQ--CANHGLNHAVLLVGYAVEN-------NIPYWILKNTWGTDWGEDGYFRVQQNINACGI 313          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATV_NPVCD (Viral cathepsin OS=Choristoneura fumiferana defective polyhedrosis virus GN=Vcath PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.743e-13
Identity = 41/126 (32.54%), Postives = 64/126 (50.79%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVAN-FTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            + YPY    G C+ ++ K  V+V   +  + + E ++   L   GPL + ++A  +  Y  GV     C    LNH VLLVGY  +          P+WI+KN+WG  WG+ GY+R+ +    CG+
Sbjct:  197 NDYPYEANNGDCRLNAAKFVVKVKKCYRYVLMFEEKLKDLLRIVGPLPVAIDASDIVNYKRGVI--RYCANHGLNHAVLLVGYAVEN-------GVPFWILKNTWGTDWGEQGYFRVQQNINACGI 313          
The following BLAST results are available for this feature:
BLAST of DC900408 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 119
Match NameE-valueIdentityDescription
CATH_PIG3.511e-1434.88Cathepsin H OS=Sus scrofa GN=CTSH PE=1 SV=1[more]
CATV_NPVRO4.586e-1434.13Viral cathepsin OS=Rachiplusia ou multiple nucleop... [more]
CATV_NPVBM4.586e-1434.92Viral cathepsin OS=Bombyx mori nuclear polyhedrosi... [more]
CATL1_CERAE4.586e-1432.81Cathepsin L1 OS=Cercopithecus aethiops GN=CTSL1 PE... [more]
CATLL_PHACE7.822e-1433.85Cathepsin L-like proteinase OS=Phaedon cochleariae... [more]
CATV_NPVAP1.022e-1332.54Viral cathepsin OS=Antheraea pernyi nuclear polyhe... [more]
CATL_DROME1.022e-1333.59Cathepsin L OS=Drosophila melanogaster GN=Cp1 PE=1... [more]
CATS_MOUSE1.334e-1333.08Cathepsin S OS=Mus musculus GN=Ctss PE=2 SV=1[more]
CATV_NPVOP1.743e-1333.33Viral cathepsin OS=Orgyia pseudotsugata multicapsi... [more]
CATV_NPVCD1.743e-1332.54Viral cathepsin OS=Choristoneura fumiferana defect... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900408 VSS Citrus sinensis cDNA clone VS28985 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900408 ID=DC900408|Name=DC900408|organism=Citrus sinensis|type=EST|length=684bp
TGAGGCCTCATGACAATGCATCCAATATTGATCGCGACTGAGGGCTAAAN
AGANAGTTCATATCCTTATATTGGGAAGCGTGGCAAATGCCAATTCGATT
CAGAGAAAATAGCCGTTCGAGTTGCAAATTTTACCAATATTCCTGTCGAT
GAGAACCAAATTGCTGCACATTTAGTCCACCACGGTCCTCTGGCTATTGG
GTTGAACGCTATATTCATGCAAACATACATTGGGGGAGTCTCATGCCCGC
TAATCTGCGGCAAGAAATGGCTCAACCACGGCGTTCTGCTCGTCGGGTAT
GGTGCCAAGGGCTTCTCAATTCTTAGGCTTGGAAACCAGCCGTATTGGAT
CATCAAGAATTCGTGGGGCAAGCAATGGGGAGACCATGGGTACTACCGGC
TCTGCCGAGGGCGTGGCATGTGTGGAATGAACACCATGGTTTCTGCAGTG
GTCACTCAAGTCTCCTCCTAAACTTGAAGTCCCTCTTATTAAGTTGGAAT
ATCTACAGAAAGCAATATAGACAGCTCATGTTATATGGTAGCTAGTTTCC
CTTTTGTTCTTGTTTGTGATCTTCTAATTATTGAAGCTTTTCCGGTTTCA
TAATTCCCCTTTCTCAAGTAAGTTCTGGATTAGACTTGAAAATGCTTTTC
AGACCTGCTCTTCTACATACTATTGTGTCTTCCA
back to top