DC900408

Overview
NameDC900408
Unique NameDC900408
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length684
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4114 contig Csv1_Contig4114:85..768. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATK_MACMU (Cathepsin K OS=Macaca mulatta GN=CTSK PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.743e-13
Identity = 43/128 (33.59%), Postives = 67/128 (52.34%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGM 429
            +YPY+G+   C ++    A +   +  IP  +E  +   +   GP+++ ++A     Q Y  GV     C    LNH VL VGYG      ++ GN+ +WIIKNSWG+ WG+ GY  + R +   CG+
Sbjct:  200 AYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYG------IQKGNK-HWIIKNSWGENWGNKGYILMARNKNNACGI 320          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATK_MACFA (Cathepsin K OS=Macaca fascicularis GN=CTSK PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.743e-13
Identity = 43/128 (33.59%), Postives = 67/128 (52.34%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGM 429
            +YPY+G+   C ++    A +   +  IP  +E  +   +   GP+++ ++A     Q Y  GV     C    LNH VL VGYG      ++ GN+ +WIIKNSWG+ WG+ GY  + R +   CG+
Sbjct:  200 AYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYG------IQKGNK-HWIIKNSWGENWGNKGYILMARNKNNACGI 320          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATK_HUMAN (Cathepsin K OS=Homo sapiens GN=CTSK PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.743e-13
Identity = 43/128 (33.59%), Postives = 67/128 (52.34%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGM 429
            +YPY+G+   C ++    A +   +  IP  +E  +   +   GP+++ ++A     Q Y  GV     C    LNH VL VGYG      ++ GN+ +WIIKNSWG+ WG+ GY  + R +   CG+
Sbjct:  200 AYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYG------IQKGNK-HWIIKNSWGENWGNKGYILMARNKNNACGI 320          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATO_HUMAN (Cathepsin O OS=Homo sapiens GN=CTSO PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.276e-13
Identity = 39/128 (30.47%), Postives = 66/128 (51.56%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEK---IAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            S YP+  + G C + S      +++  +  +    E+++A  L+  GPL + ++A+  Q Y+GG+     C     NH VL+ G+        + G+ PYWI++NSWG  WG  GY  +  G  +CG+
Sbjct:  193 SEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGI-IQHHCSSGEANHAVLITGFD-------KTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGI 312          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATM_MOUSE (Cathepsin M OS=Mus musculus GN=Ctsm PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.276e-13
Identity = 40/130 (30.77%), Postives = 66/130 (50.77%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQT--YIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRG-MCGMNT 435
            ++YPY  K G C++  E     +  F  +P +E+ +   +   GP+++ ++A       Y  G+     C    + H +LLVGYG  G        + YW++KNS G QWG+ GY ++ R +G  CG+ T
Sbjct:  200 ATYPYEEKDGSCRYSPENSTANITGFEFVPKNEDALMNAVASIGPISVAIDARHASFLFYKRGIYYEPNCSSCVVTHSMLLVGYGFTG---RESDGRKYWLVKNSMGTQWGNKGYMKISRDKGNHCGIAT 326          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATL1_HUMAN (Cathepsin L1 OS=Homo sapiens GN=CTSL1 PE=1 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 2.972e-13
Identity = 39/127 (30.71%), Postives = 64/127 (50.39%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQT--YIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRG-RGMCGM 429
            SYPY      C+++ +        F +IP  E  +   +   GP+++ ++A       Y  G+     C  + ++HGVL+VGYG   F      N  YW++KNSWG++WG  GY ++ +  R  CG+
Sbjct:  201 SYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYG---FESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGI 324          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATK_CANFA (Cathepsin K OS=Canis familiaris GN=CTSK PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.972e-13
Identity = 43/128 (33.59%), Postives = 67/128 (52.34%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGM 429
            +YPY+G+   C ++    A +   +  IP  +E  +   +   GP+++ ++A     Q Y  GV     C    LNH VL VGYG      ++ GN+ +WIIKNSWG+ WG+ GY  + R +   CG+
Sbjct:  201 AYPYVGQDESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPISVAIDASLTSFQFYSKGVYYDENCNSDNLNHAVLAVGYG------IQKGNK-HWIIKNSWGENWGNKGYILMARNKNNACGI 321          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATL6_HUMAN (Putative cathepsin L-like protein 6 OS=Homo sapiens GN=CTSLL6 PE=5 SV=3)

HSP 1 Score: 75.0998 bits (183), Expect = 3.882e-13
Identity = 44/131 (33.59%), Postives = 68/131 (51.91%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAI--GLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKN-SWGKQWGDHGYYRLCRG-RGMCGMNT 435
            +SYPY GK   C+++ +  A     F +IP  E  +A  +   GP+++  G + +  Q Y  G+     C  + L+H +LLVGY  +G       N  YW++KN S GK WG  GY ++ +  R  CG+ T
Sbjct:  143 ASYPYEGKVKTCRYNPKYSAANDTGFVDIPSQEKDLAKAVATVGPISVAAGASHVSFQFYKKGIYFEPRCDPEGLDHAMLLVGYSYEGAD---SDNNKYWLVKNSSEGKNWGMDGYIKMAKDRRNNCGIAT 270          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATK_BOVIN (Cathepsin K OS=Bos taurus GN=CTSK PE=2 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 3.882e-13
Identity = 43/128 (33.59%), Postives = 67/128 (52.34%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGM 429
            +YPY+G+   C ++    A +   +  IP  +E  +   +   GP+++ ++A     Q Y  GV     C    LNH VL VGYG      ++ GN+ +WIIKNSWG+ WG+ GY  + R +   CG+
Sbjct:  200 AYPYVGQDENCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPISVAIDASLTSFQFYRKGVYYDENCNSDNLNHAVLAVGYG------IQKGNK-HWIIKNSWGENWGNKGYILMARNKNNACGI 320          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CYSEP_PHAVU (Vignain OS=Phaseolus vulgaris PE=2 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 5.070e-13
Identity = 46/134 (34.33%), Postives = 69/134 (51.49%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKI---AVRVANFTNIPVDENQIAAHLVHHGPLAIGLNA--IFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRG----RGMCGM 429
            S+YPY  + G C  D+ K+   AV +    N+P ++       V + P+++ ++A     Q Y  GV     C    LNHGV +VGYG        +    YWI++NSWG +WG+HGY R+ R      G+CG+
Sbjct:  213 SNYPYKAQEGTC--DASKVNDLAVSIDGHENVPANDEDALLKAVANQPVSVAIDAGGSDFQFYSEGVFTG-DCSTD-LNHGVAIVGYGTT------VDGTNYWIVRNSWGPEWGEHGYIRMQRNISKKEGLCGI 336          
The following BLAST results are available for this feature:
BLAST of DC900408 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 119
Match NameE-valueIdentityDescription
CATK_MACMU1.743e-1333.59Cathepsin K OS=Macaca mulatta GN=CTSK PE=1 SV=1[more]
CATK_MACFA1.743e-1333.59Cathepsin K OS=Macaca fascicularis GN=CTSK PE=2 SV... [more]
CATK_HUMAN1.743e-1333.59Cathepsin K OS=Homo sapiens GN=CTSK PE=1 SV=1[more]
CATO_HUMAN2.276e-1330.47Cathepsin O OS=Homo sapiens GN=CTSO PE=1 SV=1[more]
CATM_MOUSE2.276e-1330.77Cathepsin M OS=Mus musculus GN=Ctsm PE=2 SV=1[more]
CATL1_HUMAN2.972e-1330.71Cathepsin L1 OS=Homo sapiens GN=CTSL1 PE=1 SV=2[more]
CATK_CANFA2.972e-1333.59Cathepsin K OS=Canis familiaris GN=CTSK PE=2 SV=1[more]
CATL6_HUMAN3.882e-1333.59Putative cathepsin L-like protein 6 OS=Homo sapien... [more]
CATK_BOVIN3.882e-1333.59Cathepsin K OS=Bos taurus GN=CTSK PE=2 SV=2[more]
CYSEP_PHAVU5.070e-1334.33Vignain OS=Phaseolus vulgaris PE=2 SV=2[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900408 VSS Citrus sinensis cDNA clone VS28985 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900408 ID=DC900408|Name=DC900408|organism=Citrus sinensis|type=EST|length=684bp
TGAGGCCTCATGACAATGCATCCAATATTGATCGCGACTGAGGGCTAAAN
AGANAGTTCATATCCTTATATTGGGAAGCGTGGCAAATGCCAATTCGATT
CAGAGAAAATAGCCGTTCGAGTTGCAAATTTTACCAATATTCCTGTCGAT
GAGAACCAAATTGCTGCACATTTAGTCCACCACGGTCCTCTGGCTATTGG
GTTGAACGCTATATTCATGCAAACATACATTGGGGGAGTCTCATGCCCGC
TAATCTGCGGCAAGAAATGGCTCAACCACGGCGTTCTGCTCGTCGGGTAT
GGTGCCAAGGGCTTCTCAATTCTTAGGCTTGGAAACCAGCCGTATTGGAT
CATCAAGAATTCGTGGGGCAAGCAATGGGGAGACCATGGGTACTACCGGC
TCTGCCGAGGGCGTGGCATGTGTGGAATGAACACCATGGTTTCTGCAGTG
GTCACTCAAGTCTCCTCCTAAACTTGAAGTCCCTCTTATTAAGTTGGAAT
ATCTACAGAAAGCAATATAGACAGCTCATGTTATATGGTAGCTAGTTTCC
CTTTTGTTCTTGTTTGTGATCTTCTAATTATTGAAGCTTTTCCGGTTTCA
TAATTCCCCTTTCTCAAGTAAGTTCTGGATTAGACTTGAAAATGCTTTTC
AGACCTGCTCTTCTACATACTATTGTGTCTTCCA
back to top