DC900407

Overview
NameDC900407
Unique NameDC900407
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length162
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900407 vs. ExPASy Swiss-Prot
Match: CYSP1_DICDI (Cysteine proteinase 1 OS=Dictyostelium discoideum GN=cprA PE=1 SV=2)

HSP 1 Score: 65.4698 bits (158), Expect = 9.851e-11
Identity = 28/43 (65.12%), Postives = 32/43 (74.42%), Query Frame = 2
Query:   26 IDGFPENFDWREKGAVTEVKMQGACGSCWAFSTTGAVEGAFFL 154
            I+  P  FDWR +GAVT VK QG CGSCW+FSTTG VEG  F+
Sbjct:  115 INSIPTAFDWRTRGAVTPVKNQGQCGSCWSFSTTGNVEGQHFI 157          
The following BLAST results are available for this feature:
BLAST of DC900407 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
CYSP1_DICDI9.851e-1165.12Cysteine proteinase 1 OS=Dictyostelium discoideum ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900407 VSS Citrus sinensis cDNA clone VS28985 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900407 ID=DC900407|Name=DC900407|organism=Citrus sinensis|type=EST|length=162bp
GAGTGGTAGTGTAAAGATGATGGAGATTGATGGATTTCCTGAGAATTTTG
ATTGGAGAGAAAAAGGTGCTGTCACTGAGGTCAAGATGCAGGGAGCATGT
GGGTCATGCTGGGCTTTTAGCACTACAGGAGCTGTTGAAGGAGCCTTTTT
TTTGCGACTGGG
back to top