DC900398

Overview
NameDC900398
Unique NameDC900398
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length602
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4027 contig Csv1_Contig4027:505..1106. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK13_HUMAN (Cell division protein kinase 13 OS=Homo sapiens GN=CDK13 PE=1 SV=2)

HSP 1 Score: 193.741 bits (491), Expect = 5.844e-49
Identity = 99/206 (48.06%), Postives = 131/206 (63.59%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSC--------SLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSP 592
            ++VALKKVR DN E E     A REI ILR+L H ++I ++ +VT +           + YLVF YM+HDL GL+ S  V F E  +K +M QL+ GL++CH    LHRDIK SN+L+++ G +K+ADFGLA  +      P T++V+TLWYRPPELLLG   Y   +D+WS GCIL EL   KPI     E+ QL  I ++CGSP
Sbjct:  729 EMVALKKVRLDN-EKEGFPITAIREIKILRQLTHQSIINMKEIVTDKEDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFNENHIKSFMRQLMEGLDYCHKKNFLHRDIKCSNILLNNRGQIKLADFGLARLYSSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRICGSP 933          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK9_SCHPO (Serine/threonine-protein kinase cdk9 OS=Schizosaccharomyces pombe GN=cdk9 PE=1 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 1.302e-48
Identity = 99/218 (45.41%), Postives = 139/218 (63.76%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSC------SLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASF------------FDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSE 598
            K+ ALK++   + E E     A REI IL+ + H N+I L  +   R         S+Y+V  YM+HDL+GL+ +P VKFTEPQ+KCYM QL +G ++ H+  +LHRD+K +NLLID+ G+LKIADFGLA                P ++   T  VVT WYR PELLLG   Y   +D+WS GCI+AE+  G+PI+ G ++++QL KI++LCGSP++
Sbjct:   60 KVYALKRILM-HTEKEGFPITAIREIKILKSIKHENIIPLSDMTVVRADKKHRRRGSIYMVTPYMDHDLSGLLENPSVKFTEPQIKCYMKQLFAGTKYLHDQLILHRDLKAANLLIDNHGILKIADFGLARVITEESYANKNPGLPPPNRREYTGCVVTRWYRSPELLLGERRYTTAIDMWSVGCIMAEMYKGRPILQGSSDLDQLDKIFRLCGSPTQ 276          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK10_MOUSE (Cell division protein kinase 10 OS=Mus musculus GN=Cdk10 PE=2 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 1.700e-48
Identity = 100/199 (50.25%), Postives = 133/199 (66.83%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSE 598
            +IVALKKVR D  +        REI +L RL HPN+++L+ +V      S++LV  Y E DLA L+ +    F+E QVKC M Q+L GL++ H N ++HRD+K SNLL+ D G +K ADFGLA  +    K PMT +VVTLWYR PELLLG T     +D+W+ GCILAELLA KP++PG +E+ Q+  I +L G+PSE
Sbjct:   63 EIVALKKVRMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQVKCIMLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVK-PMTPKVVTLWYRAPELLLGTTTQTTSIDMWAVGCILAELLAHKPLLPGTSEIHQIDLIVQLLGTPSE 260          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: BUR1_NEUCR (Serine/threonine-protein kinase bur-1 OS=Neurospora crassa GN=bur-1 PE=3 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 1.700e-48
Identity = 98/216 (45.37%), Postives = 137/216 (63.43%), Query Frame = 2
Query:    5 IVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTS-------RMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHP----------MTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +VALKK+   N          REI +L+ L H NV++LE +          R    +Y+V  YM+HDL+GL+ +P V+FTEPQVKCY+ QLL GL++ H N +LHRD+K +NLLI++ GVL+IADFGLA  ++ +   P           TS VVT WYRPPELL+    Y   +D+W  GC+ AE+L GKP++ G +++ QL  ++ LCG+PSEE
Sbjct:   51 LVALKKIIMHNERDGFPITALREIKLLKLLSHKNVLRLEEMAIEHPPRTDKRTRPIVYMVTPYMDHDLSGLLDNPSVRFTEPQVKCYLLQLLEGLKYLHANHILHRDMKAANLLINNKGVLQIADFGLARHYEGDIPQPGKGSGEGKRDYTSLVVTRWYRPPELLMHLKRYTTAIDMWGVGCVFAEMLEGKPVLQGESDLHQLELVWDLCGTPSEE 266          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK10_BOVIN (Cell division protein kinase 10 OS=Bos taurus GN=CDK10 PE=2 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 6.462e-48
Identity = 101/200 (50.50%), Postives = 136/200 (68.00%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSE 598
            +IVALKKVR D  E + V   + REI +L RL HPN+++L+ +V      S++LV  Y E DLA L+ +    F+E QVKC + Q+L GL++ H N ++HRD+K SNLL+ D G +K ADFGLA  +    K PMT +VVTLWYR PELLLG T     +D+W+ GCILAELLA KP++PG +E+ Q+  I +L G+PSE
Sbjct:   61 EIVALKKVRMDK-EKDGVPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQVKCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGIPVK-PMTPKVVTLWYRAPELLLGTTTQTTSIDMWAVGCILAELLAHKPLLPGTSEIHQVDLIVQLLGTPSE 258          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK10_HUMAN (Cell division protein kinase 10 OS=Homo sapiens GN=CDK10 PE=1 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.102e-47
Identity = 98/199 (49.25%), Postives = 133/199 (66.83%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSE 598
            +IVALKKVR D  +        REI +L RL HPN+++L+ +V      S++LV  Y E DLA L+ +    F+E QVKC + Q+L GL++ H N ++HRD+K SNLL+ D G +K ADFGLA  +    K PMT +VVTLWYR PELLLG T     +D+W+ GCILAELLA +P++PG +E+ Q+  I +L G+PSE
Sbjct:   63 EIVALKKVRMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQVKCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVK-PMTPKVVTLWYRAPELLLGTTTQTTSIDMWAVGCILAELLAHRPLLPGTSEIHQIDLIVQLLGTPSE 260          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK10_RAT (Cell division protein kinase 10 OS=Rattus norvegicus GN=Cdk10 PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 1.439e-47
Identity = 98/199 (49.25%), Postives = 133/199 (66.83%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSE 598
            +IVALKKVR D  +        REI +L RL HPN+++L+ +V      S++LV  Y E DLA L+ +    F+E QVKC + Q+L GL++ H + ++HRD+K SNLL+ D G +K ADFGLA  +    K PMT +VVTLWYR PELLLG T     +D+W+ GCILAELLA KP++PG +E+ Q+  I +L G+PSE
Sbjct:   61 EIVALKKVRMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQVKCILLQVLRGLQYLHRSFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVK-PMTPKVVTLWYRAPELLLGTTTQTTSIDMWAVGCILAELLAHKPLLPGTSEIHQIDLIVQLLGTPSE 258          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: BUR1_ASPFU (Serine/threonine-protein kinase bur1 OS=Aspergillus fumigatus GN=bur1 PE=3 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 2.455e-47
Identity = 97/215 (45.12%), Postives = 133/215 (61.86%), Query Frame = 2
Query:    5 IVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSC------SLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDP----------NHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            IVALKK+   N +        REI +L+ L H N+++L+ +   R         S+Y+V  YMEHDL+GL+ +P V FTEPQ+KCYM QLL GL++ H N +LHRD+K +NLLI ++GVL+IADFGLA  +D             K   T+ VVT WYRPPELLL    Y   +D+W  GC+  E+  GKPI+ G +++ Q   I+ L G+P+EE
Sbjct:   50 IVALKKILMHNEKDGFPITALREIKLLKMLSHRNILQLKEMAVERSKGDGRKKPSMYMVTPYMEHDLSGLLENPAVNFTEPQIKCYMLQLLEGLKYLHGNRILHRDMKAANLLISNNGVLQIADFGLARPYDEPPPEPGKGGGEAKRDYTTLVVTRWYRPPELLLQLRRYTTAIDMWGVGCVFGEMFKGKPILAGSSDLNQTQLIFNLVGTPTEE 264          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: BUR1_EMENI (Serine/threonine-protein kinase bur1 OS=Emericella nidulans GN=ptkA PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 4.188e-47
Identity = 97/215 (45.12%), Postives = 131/215 (60.93%), Query Frame = 2
Query:    5 IVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSC------SLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDP----------NHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            IVALKK+   N          REI +L+ L H N+++L  +   R         S+Y+VF YMEHDL+GL+ +PEV F+E Q+KCYM QLL GL++ H N +LHRD+K +NLLI + G+L+IADFGLA  FD             K   T+ VVT WYRPPELLL    Y   +D+W  GC+  E+  GKPI+ G +++ Q   I+ L G+P+EE
Sbjct:   50 IVALKKILMHNERDGFPITALREIKLLKMLSHTNIMQLREMAVERSKGEGRKKPSMYMVFPYMEHDLSGLLENPEVHFSEAQIKCYMIQLLEGLKYLHGNCILHRDMKAANLLISNQGILQIADFGLARPFDEAPPQPGKGAGEAKRDYTTLVVTRWYRPPELLLQLRRYTSAIDMWGVGCVFGEMFKGKPILAGNSDLNQAQLIFSLVGTPTEE 264          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: Y7597_DROME (Cell division cycle 2-like protein kinase CG7597 OS=Drosophila melanogaster GN=CG7597 PE=1 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 5.470e-47
Identity = 99/206 (48.06%), Postives = 130/206 (63.11%), Query Frame = 2
Query:    5 IVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSC--------SLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFD-PNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSP 592
            +VALKKVR ++ E E     A REI ILR+L+H N++ L  +VT +           S YLVF YM+HDL GL+ S  V F E      M QLL GL +CH    LHRDIK SN+L+++ G +K+ADFGLA  ++  + + P T++V+TLWYRPPELLLG   YG  +D+WS GCIL EL   +P+     E+ QL  I K+CGSP
Sbjct:  829 MVALKKVRLEH-EKEGFPITAVREIKILRQLNHRNIVNLHEIVTDKQDAVEFRKDKGSFYLVFEYMDHDLMGLLESGMVDFNEENNASIMKQLLDGLNYCHKKNFLHRDIKCSNILMNNRGKVKLADFGLARLYNADDRERPYTNKVITLWYRPPELLLGEERYGPSIDVWSCGCILGELFVKRPLFQANAEMAQLETISKICGSP 1033          
The following BLAST results are available for this feature:
BLAST of DC900398 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CDK13_HUMAN5.844e-4948.06Cell division protein kinase 13 OS=Homo sapiens GN... [more]
CDK9_SCHPO1.302e-4845.41Serine/threonine-protein kinase cdk9 OS=Schizosacc... [more]
CDK10_MOUSE1.700e-4850.25Cell division protein kinase 10 OS=Mus musculus GN... [more]
BUR1_NEUCR1.700e-4845.37Serine/threonine-protein kinase bur-1 OS=Neurospor... [more]
CDK10_BOVIN6.462e-4850.50Cell division protein kinase 10 OS=Bos taurus GN=C... [more]
CDK10_HUMAN1.102e-4749.25Cell division protein kinase 10 OS=Homo sapiens GN... [more]
CDK10_RAT1.439e-4749.25Cell division protein kinase 10 OS=Rattus norvegic... [more]
BUR1_ASPFU2.455e-4745.12Serine/threonine-protein kinase bur1 OS=Aspergillu... [more]
BUR1_EMENI4.188e-4745.12Serine/threonine-protein kinase bur1 OS=Emericella... [more]
Y7597_DROME5.470e-4748.06Cell division cycle 2-like protein kinase CG7597 O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900398 VSS Citrus sinensis cDNA clone VS28972 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900398 ID=DC900398|Name=DC900398|organism=Citrus sinensis|type=EST|length=602bp
CAAAATCGTAGCACTAAAGAAAGTACGGTTTGACAATTTGGAACCTGAGA
GTGTGAAATTTATGGCTAGAGAGATTCTCATATTGCGGAGATTGGATCAT
CCAAATGTTATAAAGTTGGAAGGTTTAGTGACGTCAAGGATGTCATGTAG
TTTGTACCTGGTATTTCATTATATGGAGCATGATTTGGCTGGACTTGTTG
CAAGCCCTGAAGTGAAGTTCACAGAACCACAGGTTAAATGTTACATGCAT
CAACTGCTATCTGGACTTGAGCACTGTCACAACAATGGTGTGCTTCACCG
GGACATTAAAGGCTCTAATCTTCTAATTGATGATGATGGAGTGCTTAAAA
TAGCTGATTTTGGTTTGGCATCTTTCTTTGATCCAAATCATAAGCATCCT
ATGACTAGTCGAGTGGTTACTCTTTGGTATCGACCTCCTGAGCTGCTTCT
GGGGGCTACTGATTACGGTGTGGGTGTTGATCTATGGAGCGCAGGTTGTA
TTTTAGCTGAGCTACTGGCTGGGAAGCCCATTATGCCTGGTCGTACGGAG
GTAGAGCAACTACATAAGATATATAAGTTATGTGGTTCCCCTTCAGAAGA
AT
back to top