DC900398

Overview
NameDC900398
Unique NameDC900398
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length602
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4027 contig Csv1_Contig4027:505..1106. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK9_CHICK (Cell division protein kinase 9 OS=Gallus gallus GN=CDK9 PE=2 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 5.470e-47
Identity = 108/210 (51.43%), Postives = 136/210 (64.76%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMS----C--SLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFD---PNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            K VALKKV  +N E E     A REI IL+ L H NV+ L  +  ++ S    C  S+YLVF + EHDLAGL+++  VKFT  ++K  M  LL+GL + H N +LHRD+K +N+LI  DGVLK+ADFGLA  F     +  +  T+RVVTLWYRPPELLLG  DYG  +DLW  GCI+AE+    PIM G TE  QL  I +LCGS + E
Sbjct:   43 KKVALKKVLMEN-EKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNTHVKFTLSEIKKVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGGGCIMAEMWTRSPIMQGNTEQHQLTLISQLCGSITPE 251          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CTK1_SCHPO (CTD kinase subunit alpha OS=Schizosaccharomyces pombe GN=lsk1 PE=1 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 9.330e-47
Identity = 90/196 (45.92%), Postives = 129/196 (65.82%), Query Frame = 2
Query:    5 IVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSP 592
            +VALK++R +  +        RE+ IL+RL H N+++L  ++  + S  +Y+VF YM+HDL G++ + ++ FT   +K    Q+   L + H+ GVLHRDIKGSN+L++++G LK ADFGLA F   +     T+RV+TLW+RPPELLLG T Y   VD+WSAGCI+ EL  GKP   GR E+ QL  IY + G+P
Sbjct:  302 LVALKRIRLEQEKDGFPITTVREVKILQRLRHKNIVRLLEIMVEKSS--VYMVFEYMDHDLTGVLLNSQLHFTPGNIKHLSKQIFEALAYLHHRGVLHRDIKGSNILLNNNGDLKFADFGLARFNTSSKSANYTNRVITLWFRPPELLLGETAYDTAVDIWSAGCIVMELFTGKPFFQGRDEISQLEVIYDMMGTP 495          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK9_RAT (Cell division protein kinase 9 OS=Rattus norvegicus GN=Cdk9 PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 9.330e-47
Identity = 108/208 (51.92%), Postives = 136/208 (65.38%), Query Frame = 2
Query:    8 VALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMS----C--SLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFD---PNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            VALKKV  +N E E     A REI IL+ L H NV+ L  +  ++ S    C  S+YLVF + EHDLAGL+++  VKFT  ++K  M  LL+GL + H N +LHRD+K +N+LI  DGVLK+ADFGLA  F     +  +  T+RVVTLWYRPPELLLG  DYG  +DLW AGCI+AE+    PIM G TE  QL  I +LCGS + E
Sbjct:   45 VALKKVLMEN-EKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPE 251          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK9_MOUSE (Cell division protein kinase 9 OS=Mus musculus GN=Cdk9 PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 9.330e-47
Identity = 108/208 (51.92%), Postives = 136/208 (65.38%), Query Frame = 2
Query:    8 VALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMS----C--SLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFD---PNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            VALKKV  +N E E     A REI IL+ L H NV+ L  +  ++ S    C  S+YLVF + EHDLAGL+++  VKFT  ++K  M  LL+GL + H N +LHRD+K +N+LI  DGVLK+ADFGLA  F     +  +  T+RVVTLWYRPPELLLG  DYG  +DLW AGCI+AE+    PIM G TE  QL  I +LCGS + E
Sbjct:   45 VALKKVLMEN-EKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPE 251          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK9_HUMAN (Cell division protein kinase 9 OS=Homo sapiens GN=CDK9 PE=1 SV=3)

HSP 1 Score: 186.422 bits (472), Expect = 9.330e-47
Identity = 108/208 (51.92%), Postives = 136/208 (65.38%), Query Frame = 2
Query:    8 VALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMS----C--SLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFD---PNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            VALKKV  +N E E     A REI IL+ L H NV+ L  +  ++ S    C  S+YLVF + EHDLAGL+++  VKFT  ++K  M  LL+GL + H N +LHRD+K +N+LI  DGVLK+ADFGLA  F     +  +  T+RVVTLWYRPPELLLG  DYG  +DLW AGCI+AE+    PIM G TE  QL  I +LCGS + E
Sbjct:   45 VALKKVLMEN-EKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPE 251          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK9_BOVIN (Cell division protein kinase 9 OS=Bos taurus GN=CDK9 PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 9.330e-47
Identity = 108/208 (51.92%), Postives = 136/208 (65.38%), Query Frame = 2
Query:    8 VALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMS----C--SLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFD---PNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            VALKKV  +N E E     A REI IL+ L H NV+ L  +  ++ S    C  S+YLVF + EHDLAGL+++  VKFT  ++K  M  LL+GL + H N +LHRD+K +N+LI  DGVLK+ADFGLA  F     +  +  T+RVVTLWYRPPELLLG  DYG  +DLW AGCI+AE+    PIM G TE  QL  I +LCGS + E
Sbjct:   45 VALKKVLMEN-EKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPE 251          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK9_XENTR (Cell division protein kinase 9 OS=Xenopus tropicalis GN=cdk9 PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.592e-46
Identity = 107/214 (50.00%), Postives = 138/214 (64.49%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMS--------C--SLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFD---PNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            K VALKKV  +N E E     A REI IL+ L H NV+ L  +  +++S        C  +++LVF + EHDLAGL+++  VKFT  ++K  M  LL+GL + H N +LHRD+K +N+LI  DGVLK+ADFGLA  F     +  +  T+RVVTLWYRPPELLLG  DYG  +DLW AGCI+AE+    PIM G TE  QL  I +LCGS + E
Sbjct:   43 KKVALKKVLMEN-EKEGFPITALREIKILQLLKHENVVNLIEICRTKISPTANQYNRCKGTIFLVFDFCEHDLAGLLSNAHVKFTLSEIKKVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNKYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLTLISQLCGSITPE 255          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK9B_XENLA (Cell division protein kinase 9-B OS=Xenopus laevis GN=cdk9-B PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.592e-46
Identity = 107/214 (50.00%), Postives = 138/214 (64.49%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMS--------C--SLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFD---PNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            K VALKKV  +N E E     A REI IL+ L H NV+ L  +  +++S        C  +++LVF + EHDLAGL+++  VKFT  ++K  M  LL+GL + H N +LHRD+K +N+LI  DGVLK+ADFGLA  F     +  +  T+RVVTLWYRPPELLLG  DYG  +DLW AGCI+AE+    PIM G TE  QL  I +LCGS + E
Sbjct:   43 KKVALKKVLMEN-EKEGFPITALREIKILQLLKHENVVHLIEICRNKISPTANQYNRCKGTIFLVFDFCEHDLAGLLSNAHVKFTVAEIKKVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNKYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLTLISQLCGSITPE 255          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK9A_XENLA (Cell division protein kinase 9-A OS=Xenopus laevis GN=cdk9-A PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.592e-46
Identity = 107/214 (50.00%), Postives = 138/214 (64.49%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMS--------C--SLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFD---PNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            K VALKKV  +N E E     A REI IL+ L H NV+ L  +  +++S        C  +++LVF + EHDLAGL+++  VKFT  ++K  M  LL+GL + H N +LHRD+K +N+LI  DGVLK+ADFGLA  F     +  +  T+RVVTLWYRPPELLLG  DYG  +DLW AGCI+AE+    PIM G TE  QL  I +LCGS + E
Sbjct:   43 KKVALKKVLMEN-EKEGFPITALREIKILQLLKHENVVNLIEICRTKVSPTANQYNRCKGTIFLVFDFCEHDLAGLLSNAHVKFTLSEIKKVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNKYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLTLISQLCGSITPE 255          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDKG2_ORYSJ (Cyclin-dependent kinase G-2 OS=Oryza sativa subsp. japonica GN=CDKG-2 PE=2 SV=2)

HSP 1 Score: 184.496 bits (467), Expect = 3.546e-46
Identity = 92/200 (46.00%), Postives = 134/200 (67.00%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +IVALKKV+ +           REI IL    HP+++ ++ +V      S+++V  YMEHDL G++ + +  +++ +VKC M QLL G+++ H+N VLHRD+K SNLL+++ G LKI DFGL+  +    K P T  VVTLWYR PELLLG  +Y   +D+WS GCI+AELLA +P+  G+TE EQL KI++  G+P+E+
Sbjct:  389 EIVALKKVKMEKEREGFPLTSLREINILLSFHHPSIVDVKEVVVGSSLDSIFMVMEYMEHDLKGVMEAMKQPYSQSEVKCLMLQLLEGVKYLHDNWVLHRDLKTSNLLLNNRGELKICDFGLSRQYGSPLK-PYTQLVVTLWYRAPELLLGTKEYSTAIDMWSVGCIMAELLAKEPLFNGKTEFEQLDKIFRTLGTPNEK 587          
The following BLAST results are available for this feature:
BLAST of DC900398 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CDK9_CHICK5.470e-4751.43Cell division protein kinase 9 OS=Gallus gallus GN... [more]
CTK1_SCHPO9.330e-4745.92CTD kinase subunit alpha OS=Schizosaccharomyces po... [more]
CDK9_RAT9.330e-4751.92Cell division protein kinase 9 OS=Rattus norvegicu... [more]
CDK9_MOUSE9.330e-4751.92Cell division protein kinase 9 OS=Mus musculus GN=... [more]
CDK9_HUMAN9.330e-4751.92Cell division protein kinase 9 OS=Homo sapiens GN=... [more]
CDK9_BOVIN9.330e-4751.92Cell division protein kinase 9 OS=Bos taurus GN=CD... [more]
CDK9_XENTR1.592e-4650.00Cell division protein kinase 9 OS=Xenopus tropical... [more]
CDK9B_XENLA1.592e-4650.00Cell division protein kinase 9-B OS=Xenopus laevis... [more]
CDK9A_XENLA1.592e-4650.00Cell division protein kinase 9-A OS=Xenopus laevis... [more]
CDKG2_ORYSJ3.546e-4646.00Cyclin-dependent kinase G-2 OS=Oryza sativa subsp.... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900398 VSS Citrus sinensis cDNA clone VS28972 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900398 ID=DC900398|Name=DC900398|organism=Citrus sinensis|type=EST|length=602bp
CAAAATCGTAGCACTAAAGAAAGTACGGTTTGACAATTTGGAACCTGAGA
GTGTGAAATTTATGGCTAGAGAGATTCTCATATTGCGGAGATTGGATCAT
CCAAATGTTATAAAGTTGGAAGGTTTAGTGACGTCAAGGATGTCATGTAG
TTTGTACCTGGTATTTCATTATATGGAGCATGATTTGGCTGGACTTGTTG
CAAGCCCTGAAGTGAAGTTCACAGAACCACAGGTTAAATGTTACATGCAT
CAACTGCTATCTGGACTTGAGCACTGTCACAACAATGGTGTGCTTCACCG
GGACATTAAAGGCTCTAATCTTCTAATTGATGATGATGGAGTGCTTAAAA
TAGCTGATTTTGGTTTGGCATCTTTCTTTGATCCAAATCATAAGCATCCT
ATGACTAGTCGAGTGGTTACTCTTTGGTATCGACCTCCTGAGCTGCTTCT
GGGGGCTACTGATTACGGTGTGGGTGTTGATCTATGGAGCGCAGGTTGTA
TTTTAGCTGAGCTACTGGCTGGGAAGCCCATTATGCCTGGTCGTACGGAG
GTAGAGCAACTACATAAGATATATAAGTTATGTGGTTCCCCTTCAGAAGA
AT
back to top