DC900398

Overview
NameDC900398
Unique NameDC900398
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length602
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4027 contig Csv1_Contig4027:505..1106. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDKG2_ORYSI (Cyclin-dependent kinase G-2 OS=Oryza sativa subsp. indica GN=CDKG-2 PE=2 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 3.546e-46
Identity = 92/200 (46.00%), Postives = 134/200 (67.00%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +IVALKKV+ +           REI IL    HP+++ ++ +V      S+++V  YMEHDL G++ + +  +++ +VKC M QLL G+++ H+N VLHRD+K SNLL+++ G LKI DFGL+  +    K P T  VVTLWYR PELLLG  +Y   +D+WS GCI+AELLA +P+  G+TE EQL KI++  G+P+E+
Sbjct:  389 EIVALKKVKMEKEREGFPLTSLREINILLSFHHPSIVDVKEVVVGSSLDSIFMVMEYMEHDLKGVMEAMKQPYSQSEVKCLMLQLLEGVKYLHDNWVLHRDLKTSNLLLNNRGELKICDFGLSRQYGSPLK-PYTQLVVTLWYRAPELLLGTKEYSTAIDMWSVGCIMAELLAKEPLFNGKTEFEQLDKIFRTLGTPNEK 587          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CTK1_YEAST (CTD kinase subunit alpha OS=Saccharomyces cerevisiae GN=CTK1 PE=1 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 5.120e-45
Identity = 90/198 (45.45%), Postives = 128/198 (64.65%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPS 595
            K+VALKK+R             REI +L+  DHPNV  ++ ++      ++Y++F Y ++DL+GL+ + EV+ +  Q K    QLL G+E+ H+N +LHRD+KGSN+LID+ G LKI DFGLA     N +   T+RV+TLWYRPPELLLG T+YG  VD+W  GC+L EL     I  G  E+EQ+  I+K+ G+P+
Sbjct:  207 KLVALKKLRLQGEREGFPITSIREIKLLQSFDHPNVSTIKEIMVESQK-TVYMIFEYADNDLSGLLLNKEVQISHSQCKHLFKQLLLGMEYLHDNKILHRDVKGSNILIDNQGNLKITDFGLAR--KMNSRADYTNRVITLWYRPPELLLGTTNYGTEVDMWGCGCLLVELFNKTAIFQGSNELEQIESIFKIMGTPT 401          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDKG1_ORYSJ (Cyclin-dependent kinase G-1 OS=Oryza sativa subsp. japonica GN=CDKG-1 PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 8.733e-45
Identity = 88/199 (44.22%), Postives = 132/199 (66.33%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSE 598
            +IVALKKV+ +           RE+ IL    HP++++++ +V       +++V  YMEHDL G++ + +  +++ +VKC M QLL G+++ H+N VLHRD+K SNLL+++ G LKI DFGL+  +    K P T  VVTLWYR PELLLGA DY   +D+WS GCI+ ELL+  P+  G++E++QL KI++  G+P E
Sbjct:  373 EIVALKKVKMEKEREGFPLTSLREMNILLSFHHPSIVEVKEVVVGSNDRDIFMVMEYMEHDLKGVMETMKQPYSQSEVKCLMLQLLEGVKYLHDNWVLHRDLKTSNLLLNNRGELKICDFGLSRQYGSPLK-PYTQLVVTLWYRAPELLLGAKDYSTAIDMWSLGCIMGELLSKGPLFNGKSEIDQLDKIFRTLGTPDE 570          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDKG1_ORYSI (Cyclin-dependent kinase G-1 OS=Oryza sativa subsp. indica GN=CDKG-1 PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 8.733e-45
Identity = 88/199 (44.22%), Postives = 132/199 (66.33%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSE 598
            +IVALKKV+ +           RE+ IL    HP++++++ +V       +++V  YMEHDL G++ + +  +++ +VKC M QLL G+++ H+N VLHRD+K SNLL+++ G LKI DFGL+  +    K P T  VVTLWYR PELLLGA DY   +D+WS GCI+ ELL+  P+  G++E++QL KI++  G+P E
Sbjct:  373 EIVALKKVKMEKEREGFPLTSLREMNILLSFHHPSIVEVKEVVVGSNDRDIFMVMEYMEHDLKGVMETMKQPYSQSEVKCLMLQLLEGVKYLHDNWVLHRDLKTSNLLLNNRGELKICDFGLSRQYGSPLK-PYTQLVVTLWYRAPELLLGAKDYSTAIDMWSLGCIMGELLSKGPLFNGKSEIDQLDKIFRTLGTPDE 570          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: BUR1_GIBZE (Serine/threonine-protein kinase BUR1 OS=Gibberella zeae GN=BUR1 PE=3 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 8.733e-45
Identity = 95/217 (43.78%), Postives = 133/217 (61.29%), Query Frame = 2
Query:    5 IVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTS--------RMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFD---PNHKHPM-------TSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +VALKK+   + +        REI +L+ L H N+++LE +           R    +Y+   YM+HDL+GL+ +P V+F EPQ+KCYM QLL GL + H++ +LHRD+K +NLLI++ G+L+IADFGLA  +D   P    PM       T  VVT WYRPPELLL    Y   +D+W  GC+  E+L GKPI+ G ++  QL  I+ L GSP+EE
Sbjct:   62 LVALKKIIMHHEKDGFPITALREIKLLKLLSHKNILRLEDMAIEHPTRQTDKRKKPIVYMATPYMDHDLSGLLDNPSVQFKEPQIKCYMLQLLEGLRYLHDSRILHRDMKAANLLINNKGILQIADFGLARHYDGRTPESGVPMGEGKRDYTGLVVTRWYRPPELLLQLRQYTPAIDVWGVGCVFGEMLYGKPILAGESDAAQLDIIWDLMGSPNEE 278          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK12_CAEEL (Putative cell division protein kinase 12 OS=Caenorhabditis elegans GN=cdtl-7 PE=3 SV=4)

HSP 1 Score: 179.104 bits (453), Expect = 1.490e-44
Identity = 100/206 (48.54%), Postives = 130/206 (63.11%), Query Frame = 2
Query:    8 VALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMS--------CSLYLVFHYMEHDLAGLVASPE-VKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPS 595
            VALK+VR +N E E     A REI ILR+L H N+++L  +V   +S         + YLVF Y++HDL GL+ S E V F + Q+     QLL GL + HN G LHRDIK SN+L+++ G LKIAD GLA  ++   +   T+RV+TLWYRPPELLLG   YG  +D+WS GC+L EL   KP+  G  E  QL  I K+CGSP+
Sbjct:  337 VALKRVRLEN-EKEGFPITAIREIKILRQLHHKNIVRLMDIVIDDISMDELKRTRANFYLVFEYVDHDLIGLLESKELVDFNKDQICSLFKQLLEGLAYIHNTGFLHRDIKCSNILVNNKGELKIADLGLARLWEKESRL-YTNRVITLWYRPPELLLGDERYGPAIDVWSTGCMLGELFTRKPLFNGNNEFGQLELISKVCGSPN 540          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK11_MOUSE (Cell division protein kinase 11 OS=Mus musculus GN=Cdk11 PE=1 SV=2)

HSP 1 Score: 178.333 bits (451), Expect = 2.541e-44
Identity = 88/200 (44.00%), Postives = 130/200 (65.00%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +IVALK+++ +  +        REI  + +  HPN++ +  +V       +Y+V +Y+EHDL  L+ + +  F   +VK  M QLLSG++H H+N +LHRD+K SNLL+   G+LK+ DFGLA  +    K   T  VVTLWYR PELLLGA +Y   VD+WS GCI  ELL  KP+ PG+++++Q++KI+K  G+PSE+
Sbjct:  451 EIVALKRLKMEKEKEGFPITSLREINTILKAQHPNIVTVREIVVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPGEVKTLMIQLLSGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAREYGSPLK-AYTPVVVTLWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKSDIDQINKIFKDLGTPSEK 649          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CD11B_HUMAN (Cell division protein kinase 11B OS=Homo sapiens GN=CDK11B PE=1 SV=3)

HSP 1 Score: 177.178 bits (448), Expect = 5.661e-44
Identity = 87/200 (43.50%), Postives = 129/200 (64.50%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +IVALK+++ +  +        REI  + +  HPN++ +  +V       +Y+V +Y+EHDL  L+ + +  F   +VK  M QLL G++H H+N +LHRD+K SNLL+   G+LK+ DFGLA  +    K   T  VVTLWYR PELLLGA +Y   VD+WS GCI  ELL  KP+ PG++E++Q++K++K  G+PSE+
Sbjct:  462 EIVALKRLKMEKEKEGFPITSLREINTILKAQHPNIVTVREIVVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPGEVKTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAREYGSPLK-AYTPVVVTLWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKSEIDQINKVFKDLGTPSEK 660          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDKD2_ARATH (Cyclin-dependent kinase D-2 OS=Arabidopsis thaliana GN=CDKD-2 PE=1 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 7.393e-44
Identity = 93/199 (46.73%), Postives = 130/199 (65.33%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFF-DPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSP 592
            K VA+KK+R  N + E V F A REI +L+ L+HP++++L  +       SL+LVF YM+ DL  ++    +  +   +K YM   L GL +CH   VLHRD+K +NLLI ++G+LK+ADFGLA  F  PN +   T +V   WYR PELL G+  YG GVD+W+AGCI AELL  +P +PG TE++QL KI++  G+P
Sbjct:   37 KTVAVKKIRLGN-QKEGVNFTALREIKLLKELNHPHIVEL--IDAFPHDGSLHLVFEYMQTDLEAVIRDRNIFLSPGDIKSYMLMTLKGLAYCHKKWVLHRDMKPNNLLIGENGLLKLADFGLARLFGSPNRR--FTHQVFATWYRAPELLFGSRQYGAGVDVWAAGCIFAELLLRRPFLPGSTEIDQLGKIFQAFGTP 230          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK11_RAT (Cell division protein kinase 11 OS=Rattus norvegicus GN=Cdk11 PE=2 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 9.656e-44
Identity = 87/200 (43.50%), Postives = 129/200 (64.50%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +IVALK+++ +  +        REI  + +  HPN++ +  +V       +Y+V +Y+EHDL  L+ + +  F   +VK  M QLLSG++H H+N +LHRD+K SNLL+   G+LK+ DFGLA  +    K   T  VVTLWYR PELLLGA +Y    D+WS GCI  ELL  KP+ PG+++++Q++KI+K  G+PSE+
Sbjct:  103 EIVALKRLKMEKEKEGFPLTSIREINTILKAQHPNIVTVREIVVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPGEVKTLMIQLLSGVKHLHDNWILHRDLKTSNLLLTHAGILKVGDFGLAREYGSPLK-AYTPVVVTLWYRAPELLLGAKEYSTACDMWSVGCIFGELLTQKPLFPGKSDIDQINKIFKDIGTPSEK 301          
The following BLAST results are available for this feature:
BLAST of DC900398 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CDKG2_ORYSI3.546e-4646.00Cyclin-dependent kinase G-2 OS=Oryza sativa subsp.... [more]
CTK1_YEAST5.120e-4545.45CTD kinase subunit alpha OS=Saccharomyces cerevisi... [more]
CDKG1_ORYSJ8.733e-4544.22Cyclin-dependent kinase G-1 OS=Oryza sativa subsp.... [more]
CDKG1_ORYSI8.733e-4544.22Cyclin-dependent kinase G-1 OS=Oryza sativa subsp.... [more]
BUR1_GIBZE8.733e-4543.78Serine/threonine-protein kinase BUR1 OS=Gibberella... [more]
CDK12_CAEEL1.490e-4448.54Putative cell division protein kinase 12 OS=Caenor... [more]
CDK11_MOUSE2.541e-4444.00Cell division protein kinase 11 OS=Mus musculus GN... [more]
CD11B_HUMAN5.661e-4443.50Cell division protein kinase 11B OS=Homo sapiens G... [more]
CDKD2_ARATH7.393e-4446.73Cyclin-dependent kinase D-2 OS=Arabidopsis thalian... [more]
CDK11_RAT9.656e-4443.50Cell division protein kinase 11 OS=Rattus norvegic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900398 VSS Citrus sinensis cDNA clone VS28972 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900398 ID=DC900398|Name=DC900398|organism=Citrus sinensis|type=EST|length=602bp
CAAAATCGTAGCACTAAAGAAAGTACGGTTTGACAATTTGGAACCTGAGA
GTGTGAAATTTATGGCTAGAGAGATTCTCATATTGCGGAGATTGGATCAT
CCAAATGTTATAAAGTTGGAAGGTTTAGTGACGTCAAGGATGTCATGTAG
TTTGTACCTGGTATTTCATTATATGGAGCATGATTTGGCTGGACTTGTTG
CAAGCCCTGAAGTGAAGTTCACAGAACCACAGGTTAAATGTTACATGCAT
CAACTGCTATCTGGACTTGAGCACTGTCACAACAATGGTGTGCTTCACCG
GGACATTAAAGGCTCTAATCTTCTAATTGATGATGATGGAGTGCTTAAAA
TAGCTGATTTTGGTTTGGCATCTTTCTTTGATCCAAATCATAAGCATCCT
ATGACTAGTCGAGTGGTTACTCTTTGGTATCGACCTCCTGAGCTGCTTCT
GGGGGCTACTGATTACGGTGTGGGTGTTGATCTATGGAGCGCAGGTTGTA
TTTTAGCTGAGCTACTGGCTGGGAAGCCCATTATGCCTGGTCGTACGGAG
GTAGAGCAACTACATAAGATATATAAGTTATGTGGTTCCCCTTCAGAAGA
AT
back to top