DC900398

Overview
NameDC900398
Unique NameDC900398
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length602
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4027 contig Csv1_Contig4027:505..1106. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CSK21_XENLA (Casein kinase II subunit alpha OS=Xenopus laevis GN=csnk2a1 PE=2 SV=2)

HSP 1 Score: 108.227 bits (269), Expect = 3.229e-23
Identity = 66/195 (33.85%), Postives = 113/195 (57.95%), Query Frame = 2
Query:   17 KKVRFDNLEPESVKFMAREILILRRL-DHPNVIKLEGLVTSRMSCSLYLVFHYMEH-DLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLID-DDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGK-PIMPGRTEVEQLHKIYKLCGS 589
            +KV    L+P   K + REI IL  L   PN+I L  +V   +S +  LVF ++ + D   L  +     T+  ++ YM+++L  L++CH+ G++HRD+K  N++ID +   L++ D+GLA F+ P  ++ +  RV + +++ PELL+    Y   +D+WS GC+LA ++  K P   G    +QL +I K+ G+
Sbjct:   63 EKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQT----LTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNV--RVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGT 251          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CSK21_RAT (Casein kinase II subunit alpha OS=Rattus norvegicus GN=Csnk2a1 PE=1 SV=2)

HSP 1 Score: 108.227 bits (269), Expect = 3.229e-23
Identity = 66/195 (33.85%), Postives = 113/195 (57.95%), Query Frame = 2
Query:   17 KKVRFDNLEPESVKFMAREILILRRL-DHPNVIKLEGLVTSRMSCSLYLVFHYMEH-DLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLID-DDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGK-PIMPGRTEVEQLHKIYKLCGS 589
            +KV    L+P   K + REI IL  L   PN+I L  +V   +S +  LVF ++ + D   L  +     T+  ++ YM+++L  L++CH+ G++HRD+K  N++ID +   L++ D+GLA F+ P  ++ +  RV + +++ PELL+    Y   +D+WS GC+LA ++  K P   G    +QL +I K+ G+
Sbjct:   63 EKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQT----LTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNV--RVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGT 251          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CSK21_MOUSE (Casein kinase II subunit alpha OS=Mus musculus GN=Csnk2a1 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 3.229e-23
Identity = 66/195 (33.85%), Postives = 113/195 (57.95%), Query Frame = 2
Query:   17 KKVRFDNLEPESVKFMAREILILRRL-DHPNVIKLEGLVTSRMSCSLYLVFHYMEH-DLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLID-DDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGK-PIMPGRTEVEQLHKIYKLCGS 589
            +KV    L+P   K + REI IL  L   PN+I L  +V   +S +  LVF ++ + D   L  +     T+  ++ YM+++L  L++CH+ G++HRD+K  N++ID +   L++ D+GLA F+ P  ++ +  RV + +++ PELL+    Y   +D+WS GC+LA ++  K P   G    +QL +I K+ G+
Sbjct:   63 EKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQT----LTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNV--RVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGT 251          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CSK21_HUMAN (Casein kinase II subunit alpha OS=Homo sapiens GN=CSNK2A1 PE=1 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 3.229e-23
Identity = 66/195 (33.85%), Postives = 113/195 (57.95%), Query Frame = 2
Query:   17 KKVRFDNLEPESVKFMAREILILRRL-DHPNVIKLEGLVTSRMSCSLYLVFHYMEH-DLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLID-DDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGK-PIMPGRTEVEQLHKIYKLCGS 589
            +KV    L+P   K + REI IL  L   PN+I L  +V   +S +  LVF ++ + D   L  +     T+  ++ YM+++L  L++CH+ G++HRD+K  N++ID +   L++ D+GLA F+ P  ++ +  RV + +++ PELL+    Y   +D+WS GC+LA ++  K P   G    +QL +I K+ G+
Sbjct:   63 EKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQT----LTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNV--RVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGT 251          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CSK21_CHICK (Casein kinase II subunit alpha OS=Gallus gallus GN=CSNK2A1 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 3.229e-23
Identity = 66/195 (33.85%), Postives = 113/195 (57.95%), Query Frame = 2
Query:   17 KKVRFDNLEPESVKFMAREILILRRL-DHPNVIKLEGLVTSRMSCSLYLVFHYMEH-DLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLID-DDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGK-PIMPGRTEVEQLHKIYKLCGS 589
            +KV    L+P   K + REI IL  L   PN+I L  +V   +S +  LVF ++ + D   L  +     T+  ++ YM+++L  L++CH+ G++HRD+K  N++ID +   L++ D+GLA F+ P  ++ +  RV + +++ PELL+    Y   +D+WS GC+LA ++  K P   G    +QL +I K+ G+
Sbjct:   63 EKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQT----LTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNV--RVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGT 251          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CSK21_BOVIN (Casein kinase II subunit alpha OS=Bos taurus GN=CSNK2A1 PE=1 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 3.229e-23
Identity = 66/195 (33.85%), Postives = 113/195 (57.95%), Query Frame = 2
Query:   17 KKVRFDNLEPESVKFMAREILILRRL-DHPNVIKLEGLVTSRMSCSLYLVFHYMEH-DLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLID-DDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGK-PIMPGRTEVEQLHKIYKLCGS 589
            +KV    L+P   K + REI IL  L   PN+I L  +V   +S +  LVF ++ + D   L  +     T+  ++ YM+++L  L++CH+ G++HRD+K  N++ID +   L++ D+GLA F+ P  ++ +  RV + +++ PELL+    Y   +D+WS GC+LA ++  K P   G    +QL +I K+ G+
Sbjct:   63 EKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQT----LTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNV--RVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGT 251          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CSK23_ARATH (Probable casein kinase II subunit alpha OS=Arabidopsis thaliana GN=At2g23080 PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 4.218e-23
Identity = 65/187 (34.76%), Postives = 110/187 (58.82%), Query Frame = 2
Query:   38 LEPESVKFMAREILILRRL-DHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDD-GVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGK-PIMPGRTEVEQLHKIYKLCGS 589
            L+P   K + REI IL+ L   PN++KL  +V    S +  LVF ++ + +   V  P +  T+  ++ Y+++LL  L+ CH+ G++HRD+K  N++ID     L++ D+GLA F+ P  ++ +  RV + +++ PELL+   DY   +D+WS GC+ A ++  K P   G    +QL KI K+ G+
Sbjct:   65 LKPVKKKKIKREIKILQNLCGGPNIVKLYDIVRDEHSKTPSLVFEFV-NSVDFKVLYPTL--TDYDIRYYIYELLKALDFCHSQGIMHRDVKPHNVMIDHQLRKLRLIDWGLAEFYHPGKEYNV--RVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGT 246          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: YL673_MIMIV (Putative serine/threonine-protein kinase L673 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L673 PE=3 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 5.508e-23
Identity = 68/200 (34.00%), Postives = 107/200 (53.50%), Query Frame = 2
Query:    8 VALKKVRFDNLEPESVKFMAREILILRRLD-HPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSR-VVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +A+KK+R  +        M RE+  L  L  HPN+I +EG     ++ ++Y+    M+  LA  +    +  +E     Y+ QLL  + + H+ G++HRD+  SN+LI     LKI DFG A FF  +      +R V ++ YR  ELL+G   Y   +D+WS GC++ E+L GK I  G  E E ++KI+ + G P  +
Sbjct:  288 IAMKKIRNKSTFVIDSN-MIREVNNLMILSGHPNIINIEGYYYWDLTSTMYIGLDLMDTSLAIYLTKNNI--SESLKIKYVLQLLEAINYMHSKGIMHRDLSASNILIKGS-TLKIGDFGSARFFSGDTLDTKYTRNVCSINYRAMELLMGIFPYNNKIDIWSCGCLITEILTGKRIFNGLKEAEVINKIHDILGVPDAD 483          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: YL670_MIMIV (Putative serine/threonine-protein kinase L670 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L670 PE=3 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 5.508e-23
Identity = 75/207 (36.23%), Postives = 108/207 (52.17%), Query Frame = 2
Query:   14 LKKVRFDNLE-----------PESVKFMAREILILRRLDHPNVIKLEGLVTSR----MSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASF-FDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCG 586
            + KV+FDN E            E +    REI  +  LDHPN+IK+ G   S+    +   L  +  Y + D   L  SPE+K      K ++ QLL GL++ HNN ++HRD+  SN+LI  D  LKI DFG + F +D       +  V ++ YR  E+L G   Y   +D+WS  C++AE+L  K +  GR E+E L  I +L G
Sbjct:  272 VNKVKFDNTEIALKTHHPDDSKEIIVESLREINNMIMLDHPNIIKMHGYYYSQGITHIGLELCDMPLYKKLDKGNL--SPELK------KSFIIQLLCGLKYLHNNNIIHRDLTSSNVLIKGD-TLKICDFGCSRFVYDKKIIGNYSLDVCSVRYRAIEILNGILPYNEKIDIWSCACLIAEILGEKFLFRGRNEIEVLDSINRLLG 469          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CSK21_RABIT (Casein kinase II subunit alpha OS=Oryctolagus cuniculus GN=CSNK2A1 PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.603e-22
Identity = 65/195 (33.33%), Postives = 111/195 (56.92%), Query Frame = 2
Query:   17 KKVRFDNLEPESVKFMAREILILRRL-DHPNVIKLEGLVTSRMSCSLYLVFHYMEH-DLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLID-DDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGK-PIMPGRTEVEQLHKIYKLCGS 589
            +KV    L+P   K + REI IL  L   PN+I L  +V    S +  L F ++ + D   L  +     T+  ++ YM+++L  L++CH+ G++HRD+K  N++ID +   L++ D+GLA F+ P  ++ +  RV + +++ PELL+    Y   +D+WS GC+LA ++  K P   G    +QL +I K+ G+
Sbjct:   63 EKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPASRTPALAFEHVNNTDFKQLYQT----LTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNV--RVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGT 251          
The following BLAST results are available for this feature:
BLAST of DC900398 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CSK21_XENLA3.229e-2333.85Casein kinase II subunit alpha OS=Xenopus laevis G... [more]
CSK21_RAT3.229e-2333.85Casein kinase II subunit alpha OS=Rattus norvegicu... [more]
CSK21_MOUSE3.229e-2333.85Casein kinase II subunit alpha OS=Mus musculus GN=... [more]
CSK21_HUMAN3.229e-2333.85Casein kinase II subunit alpha OS=Homo sapiens GN=... [more]
CSK21_CHICK3.229e-2333.85Casein kinase II subunit alpha OS=Gallus gallus GN... [more]
CSK21_BOVIN3.229e-2333.85Casein kinase II subunit alpha OS=Bos taurus GN=CS... [more]
CSK23_ARATH4.218e-2334.76Probable casein kinase II subunit alpha OS=Arabido... [more]
YL673_MIMIV5.508e-2334.00Putative serine/threonine-protein kinase L673 OS=A... [more]
YL670_MIMIV5.508e-2336.23Putative serine/threonine-protein kinase L670 OS=A... [more]
CSK21_RABIT1.603e-2233.33Casein kinase II subunit alpha OS=Oryctolagus cuni... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900398 VSS Citrus sinensis cDNA clone VS28972 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900398 ID=DC900398|Name=DC900398|organism=Citrus sinensis|type=EST|length=602bp
CAAAATCGTAGCACTAAAGAAAGTACGGTTTGACAATTTGGAACCTGAGA
GTGTGAAATTTATGGCTAGAGAGATTCTCATATTGCGGAGATTGGATCAT
CCAAATGTTATAAAGTTGGAAGGTTTAGTGACGTCAAGGATGTCATGTAG
TTTGTACCTGGTATTTCATTATATGGAGCATGATTTGGCTGGACTTGTTG
CAAGCCCTGAAGTGAAGTTCACAGAACCACAGGTTAAATGTTACATGCAT
CAACTGCTATCTGGACTTGAGCACTGTCACAACAATGGTGTGCTTCACCG
GGACATTAAAGGCTCTAATCTTCTAATTGATGATGATGGAGTGCTTAAAA
TAGCTGATTTTGGTTTGGCATCTTTCTTTGATCCAAATCATAAGCATCCT
ATGACTAGTCGAGTGGTTACTCTTTGGTATCGACCTCCTGAGCTGCTTCT
GGGGGCTACTGATTACGGTGTGGGTGTTGATCTATGGAGCGCAGGTTGTA
TTTTAGCTGAGCTACTGGCTGGGAAGCCCATTATGCCTGGTCGTACGGAG
GTAGAGCAACTACATAAGATATATAAGTTATGTGGTTCCCCTTCAGAAGA
AT
back to top