DC900398

Overview
NameDC900398
Unique NameDC900398
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length602
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4027 contig Csv1_Contig4027:505..1106. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK2_CARAU (Cell division protein kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.180e-41
Identity = 93/199 (46.73%), Postives = 126/199 (63.32%), Query Frame = 2
Query:    8 VALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVK-FTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSE 598
            VALKK+R D  E E V   A REI +L+ L+HPN++KL  ++ +     LYLVF ++  DL   + S  V   + P VK Y+ QLL GL  CH++ VLHRD+K  NLLI+  G +K+ADFGLA  F    +   T  VVTLWYR PE+LLG   Y   VD+WS GCI AE++  K + PG +E++QL +I++  G+P E
Sbjct:   30 VALKKIRLDT-ETEGVPSTAIREISLLKELNHPNIVKLHDVIHTENK--LYLVFEFLHQDLKRFMDSSTVTGISLPLVKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINAQGEIKLADFGLARAFGVPVR-TYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMITRKALFPGDSEIDQLFRIFRTLGTPDE 224          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK2_XENLA (Cell division protein kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3)

HSP 1 Score: 169.088 bits (427), Expect = 1.542e-41
Identity = 91/201 (45.27%), Postives = 127/201 (63.18%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVK-FTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSE 598
            +IVALKK+R D  E E V   A REI +L+ L+HPN++KL  ++ +     LYLVF ++  DL   +    +   +   VK Y+ QLL GL  CH++ VLHRD+K  NLLI+ DG +K+ADFGLA  F    +   T  VVTLWYR PE+LLG   Y   VD+WS GCI AE++  + + PG +E++QL +I++  G+P E
Sbjct:   28 EIVALKKIRLDT-ETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENK--LYLVFEFLNQDLKKFMDGSNISGISLALVKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINSDGAIKLADFGLARAFGVPVR-TFTHEVVTLWYRAPEILLGCKFYSTAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDE 224          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK2_BOVIN (Cell division protein kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.542e-41
Identity = 92/201 (45.77%), Postives = 128/201 (63.68%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLV-ASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSE 598
            ++VALKK+R D  E E V   A REI +L+ L+HPN++KL  ++ +     LYLVF ++  DL   + AS       P +K Y+ QLL GL  CH++ VLHRD+K  NLLI+ DG +K+ADFGLA  F    +   T  VVTLWYR PE+LLG   Y   VD+WS GCI AE++  + + PG +E++QL +I++  G+P E
Sbjct:   28 EVVALKKIRLDT-ETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENK--LYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINADGSIKLADFGLARAFGVPVR-TYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDE 224          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: BUR1_YARLI (Serine/threonine-protein kinase BUR1 OS=Yarrowia lipolytica GN=BUR1 PE=3 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.542e-41
Identity = 91/213 (42.72%), Postives = 126/213 (59.15%), Query Frame = 2
Query:    8 VALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCS------LYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFD---PN------HKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            VALKK+   + +        REI IL+ L H NVI L  L   R   S      +Y+V  YM+HDLAGL+ +  V+ +   +KCYM QLL G+ + H    LHRDIK +N+L++D G+LK+ADFGLA  +D   PN      +   +T+ VVT WYRPPEL+LG   Y   +D+W  GC+  E    KPI PG ++V+Q  KI++  G P+E+
Sbjct:   64 VALKKILLHSEKEGFPVTALREIRILKLLRHENVIPLVDLAVERGDQSKKERGCVYMVTPYMDHDLAGLLGNQSVQLSPAHIKCYMLQLLEGIGYLHAKKFLHRDIKAANILVNDQGILKLADFGLARGYDGPAPNSQTAGVNTENLTAMVVTRWYRPPELILGDRKYTTAIDMWGIGCVFGEFFTRKPIFPGASDVDQGSKIFQAVGVPTED 276          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK2_HUMAN (Cell division protein kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2)

HSP 1 Score: 168.703 bits (426), Expect = 2.013e-41
Identity = 91/201 (45.27%), Postives = 128/201 (63.68%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLV-ASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSE 598
            ++VALKK+R D  E E V   A REI +L+ L+HPN++KL  ++ +     LYLVF ++  DL   + AS       P +K Y+ QLL GL  CH++ VLHRD+K  NLLI+ +G +K+ADFGLA  F    +   T  VVTLWYR PE+LLG   Y   VD+WS GCI AE++  + + PG +E++QL +I++  G+P E
Sbjct:   28 EVVALKKIRLDT-ETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENK--LYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVR-TYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDE 224          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC22_MEDSA (Cell division control protein 2 homolog 2 OS=Medicago sativa GN=CDC2B PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 2.013e-41
Identity = 89/201 (44.28%), Postives = 134/201 (66.67%), Query Frame = 2
Query:    8 VALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLV-ASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLID-DDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +ALKK+R +  E E V   A REI +L+ + H N+++L+ +V S     LYLVF Y++ DL   + +SPE    + Q+K +++Q+L G+ +CH++ VLHRD+K  NLLID     +K+ADFGLA  F    +   T  VVTLWYR PE+LLG+  Y   VD+WS GCI AE++  +P+ PG +E+++L KI+++ G+P+EE
Sbjct:   30 IALKKIRLEQ-EDEGVPSTAIREISLLKEMQHRNIVRLQDVVHSEKR--LYLVFEYLDLDLKKFMDSSPEFAKDQRQIKMFLYQILCGIAYCHSHRVLHRDLKPQNLLIDRSSNAVKLADFGLARAFGIPVR-TFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMINQRPLFPGDSEIDELFKIFRITGTPNEE 226          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK2_CRIGR (Cell division protein kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 3.434e-41
Identity = 91/201 (45.27%), Postives = 128/201 (63.68%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLV-ASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSE 598
            ++VALKK+R D  E E V   A REI +L+ L+HPN++KL  ++ +     LYLVF ++  DL   + AS       P +K Y+ QLL GL  CH++ VLHRD+K  NLLI+ +G +K+ADFGLA  F    +   T  VVTLWYR PE+LLG   Y   VD+WS GCI AE++  + + PG +E++QL +I++  G+P E
Sbjct:   28 EVVALKKIRLDT-ETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENK--LYLVFEFLHQDLKKFMDASAVTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINAEGSIKLADFGLARAFGVPVR-TYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDE 224          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK3_HUMAN (Cell division protein kinase 3 OS=Homo sapiens GN=CDK3 PE=1 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 4.485e-41
Identity = 91/202 (45.05%), Postives = 132/202 (65.35%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVAS-PEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            ++VALKK+R D LE E V   A REI +L+ L HPN+++L  +V +     LYLVF ++  DL   + S P  +     +K Y+ QLL G+  CH++ V+HRD+K  NLLI++ G +K+ADFGLA  F    +   T  VVTLWYR PE+LLG+  Y   VD+WS GCI AE++  K + PG +E++QL +I+++ G+PSE+
Sbjct:   28 QLVALKKIRLD-LEMEGVPSTAIREISLLKELKHPNIVRLLDVVHNERK--LYLVFEFLSQDLKKYMDSTPGSELPLHLIKSYLFQLLQGVSFCHSHRVIHRDLKPQNLLINELGAIKLADFGLARAFGVPLR-TYTHEVVTLWYRAPEILLGSKFYTTAVDIWSIGCIFAEMVTRKALFPGDSEIDQLFRIFRMLGTPSED 225          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK2_RAT (Cell division protein kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 4.485e-41
Identity = 91/201 (45.27%), Postives = 128/201 (63.68%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLV-ASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSE 598
            ++VALKK+R D  E E V   A REI +L+ L+HPN++KL  ++ +     LYLVF ++  DL   + AS       P +K Y+ QLL GL  CH++ VLHRD+K  NLLI+ +G +K+ADFGLA  F    +   T  VVTLWYR PE+LLG   Y   VD+WS GCI AE++  + + PG +E++QL +I++  G+P E
Sbjct:   28 EVVALKKIRLDT-ETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENK--LYLVFEFLHQDLKKFMDASALTGLPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINAEGSIKLADFGLARAFGVPVR-TYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDE 224          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK2_MESAU (Cell division protein kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 9.992e-41
Identity = 91/201 (45.27%), Postives = 127/201 (63.18%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLV-ASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSE 598
            ++VALKK+R D  E E V   A REI +L+ L+HPN++KL  ++ +     LYLVF  +  DL   + AS       P +K Y+ QLL GL  CH++ VLHRD+K  NLLI+ +G +K+ADFGLA  F    +   T  VVTLWYR PE+LLG   Y   VD+WS GCI AE++  + + PG +E++QL +I++  G+P E
Sbjct:   28 EVVALKKIRLDT-ETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENK--LYLVFELLHQDLKKFMDASAVTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINAEGSIKLADFGLARAFGVPVR-TYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDE 224          
The following BLAST results are available for this feature:
BLAST of DC900398 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CDK2_CARAU1.180e-4146.73Cell division protein kinase 2 OS=Carassius auratu... [more]
CDK2_XENLA1.542e-4145.27Cell division protein kinase 2 OS=Xenopus laevis G... [more]
CDK2_BOVIN1.542e-4145.77Cell division protein kinase 2 OS=Bos taurus GN=CD... [more]
BUR1_YARLI1.542e-4142.72Serine/threonine-protein kinase BUR1 OS=Yarrowia l... [more]
CDK2_HUMAN2.013e-4145.27Cell division protein kinase 2 OS=Homo sapiens GN=... [more]
CDC22_MEDSA2.013e-4144.28Cell division control protein 2 homolog 2 OS=Medic... [more]
CDK2_CRIGR3.434e-4145.27Cell division protein kinase 2 OS=Cricetulus grise... [more]
CDK3_HUMAN4.485e-4145.05Cell division protein kinase 3 OS=Homo sapiens GN=... [more]
CDK2_RAT4.485e-4145.27Cell division protein kinase 2 OS=Rattus norvegicu... [more]
CDK2_MESAU9.992e-4145.27Cell division protein kinase 2 OS=Mesocricetus aur... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900398 VSS Citrus sinensis cDNA clone VS28972 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900398 ID=DC900398|Name=DC900398|organism=Citrus sinensis|type=EST|length=602bp
CAAAATCGTAGCACTAAAGAAAGTACGGTTTGACAATTTGGAACCTGAGA
GTGTGAAATTTATGGCTAGAGAGATTCTCATATTGCGGAGATTGGATCAT
CCAAATGTTATAAAGTTGGAAGGTTTAGTGACGTCAAGGATGTCATGTAG
TTTGTACCTGGTATTTCATTATATGGAGCATGATTTGGCTGGACTTGTTG
CAAGCCCTGAAGTGAAGTTCACAGAACCACAGGTTAAATGTTACATGCAT
CAACTGCTATCTGGACTTGAGCACTGTCACAACAATGGTGTGCTTCACCG
GGACATTAAAGGCTCTAATCTTCTAATTGATGATGATGGAGTGCTTAAAA
TAGCTGATTTTGGTTTGGCATCTTTCTTTGATCCAAATCATAAGCATCCT
ATGACTAGTCGAGTGGTTACTCTTTGGTATCGACCTCCTGAGCTGCTTCT
GGGGGCTACTGATTACGGTGTGGGTGTTGATCTATGGAGCGCAGGTTGTA
TTTTAGCTGAGCTACTGGCTGGGAAGCCCATTATGCCTGGTCGTACGGAG
GTAGAGCAACTACATAAGATATATAAGTTATGTGGTTCCCCTTCAGAAGA
AT
back to top