DC900398

Overview
NameDC900398
Unique NameDC900398
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length602
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4027 contig Csv1_Contig4027:505..1106. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC21_MEDSA (Cell division control protein 2 homolog 1 (Fragment) OS=Medicago sativa GN=CDC2A PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 1.884e-39
Identity = 90/201 (44.78%), Postives = 132/201 (65.67%), Query Frame = 2
Query:    8 VALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAG-LVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDD-DGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +ALKK+R +  E E V   A REI +L+ + H N+++L+ +V S     LYLVF Y++ DL   + +SPE      QVK +++Q+L G+ +CH++ VLHRD+K  NLLID     LK+ADFGLA  F    +   T  VVTLWYR PE+LLG+  Y   VD+WS GCI AE+   +P+ PG +E+++L KI+++ G+P+E+
Sbjct:   27 IALKKIRLEQ-EDEGVPSTAIREISLLKEMQHRNIVRLQDVVHSDKR--LYLVFEYLDLDLKKHMDSSPEFIKDPRQVKMFLYQMLCGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLARAFGIPVR-TFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMANRRPLSPGDSEIDELFKIFRILGTPNED 223          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: YP62_CAEEL (Putative serine/threonine-protein kinase B0495.2 OS=Caenorhabditis elegans GN=B0495.2 PE=2 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 2.461e-39
Identity = 90/205 (43.90%), Postives = 131/205 (63.90%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REI-LILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLV---ASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLA-SFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSE 598
            +IVALK+++ +  E E     A REI ++L+  +HPN++ ++ ++       +Y+   ++EHD+  L+   +    +F+  + K  + QLLSG+EH H   +LHRD+K SNLL+   G+LKIADFGLA  + DP  K   TS VVTLWYR PELLLG   Y   VD+WS GCI+AE +  KP+ PGR E+EQ+ KI+   G+P+E
Sbjct:  380 EIVALKRLKMEK-EKEGFPITALREINMLLKAGNHPNIVNVKEILLGSNMDKIYMAMEFVEHDMKSLLDTMSRRNKRFSIGEQKTLLQQLLSGIEHMHKLWILHRDLKTSNLLMSHKGILKIADFGLAREYGDPLKK--FTSIVVTLWYRSPELLLGTRLYSTPVDMWSVGCIMAEFILLKPLFPGRGELEQIKKIFMEMGTPTE 581          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: Y8487_DICDI (Probable cyclin-dependent serine/threonine-protein kinase DDB_G0278487 OS=Dictyostelium discoideum GN=DDB_G0278487 PE=2 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 2.461e-39
Identity = 81/178 (45.51%), Postives = 118/178 (66.29%), Query Frame = 2
Query:   71 EILILRRLDH-PNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            E  +L++L H P +  +  + T+  +    +VF Y EHDL+GL++  E + + PQVKCY  QLL G+   HN GV+HRDIK +NLL+++ G L I D G A+ +    +   +S+VVTLWYR PELLLG+T YG  +D+WS GC+L EL+  +  +PG +E +QL  I KLCG+P++E
Sbjct:  108 ECSLLQQLRHIPYITPVIDIYTNFETSEYIIVFPYFEHDLSGLLS--EHRLSIPQVKCYFKQLLEGINEIHNAGVMHRDIKAANLLVNNKGSLFIGDLGTATSY--TKRSVFSSKVVTLWYRAPELLLGSTQYGPEIDMWSIGCVLIELVTSRNFLPGSSEQQQLEAICKLCGTPTDE 281          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK20_HUMAN (Cell division protein kinase 20 OS=Homo sapiens GN=CDK20 PE=1 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 2.461e-39
Identity = 87/201 (43.28%), Postives = 118/201 (58.71%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRL-DHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +IVALKKV    LE        REI  L+ + D+  V++L+ +          L F +M  DLA +V   +    + QVK Y+  LL G+  CH N ++HRD+K +NLLI   G LKIADFGLA  F P+     T +V T WYR PELL GA  Y  GVDLWS GCI+ ELL G P+ PG+ ++EQL  + ++ G+P+ +
Sbjct:   28 EIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPH--GGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRWYRAPELLYGARQYDQGVDLWSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQ 226          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2_CHERU (Cell division control protein 2 homolog OS=Chenopodium rubrum GN=CDC2 PE=2 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 2.461e-39
Identity = 89/201 (44.28%), Postives = 130/201 (64.68%), Query Frame = 2
Query:    8 VALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVAS-PEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLID-DDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +ALKK+R +  E E V   A REI +L+ + H N+++L+ +V S     LYLVF Y++ DL   + S P+       +K +++Q+L G+ +CH++ VLHRD+K  NLLID     LK+ADFGLA  F    +   T  VVTLWYR PE+LLG+  Y   VD+WS GCI AE++  KP+ PG +E+++L KI++  G+P+EE
Sbjct:   30 IALKKIRLEQ-EDEGVPSTAIREISLLKEMQHGNIVRLQDVVHSEKR--LYLVFEYLDLDLKKHMDSCPDFAKDPRMIKRFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRQTNALKLADFGLARAFGIPVR-TFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQKPLFPGDSEIDELFKIFRTLGTPNEE 226          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2H_PLABA (Cell division control protein 2 homolog OS=Plasmodium berghei (strain Anka) GN=CRK2 PE=2 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 2.461e-39
Identity = 82/198 (41.41%), Postives = 126/198 (63.64%), Query Frame = 2
Query:   11 ALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFD-PNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            ALKK+R +  +        REI IL+ L H N++KL  ++ ++    L LVF +++ DL  L+   +        K ++ QLL+G+ +CH + VLHRD+K  NLLI+ +G LKIADFGLA  F  P  ++  T  VVTLWYR P++L+G+  Y   +D+WS GCI AE++ G+P+ PG +E +QL +I+K+ G+P+ +
Sbjct:   30 ALKKIRLEKEDEGIPSTAIREISILKELRHSNIVKLYDVIHAKKR--LILVFEHLDQDLKKLIDVCDGGLESVTAKSFLLQLLNGIAYCHEHRVLHRDLKPQNLLINREGELKIADFGLARAFGIPARRY--THEVVTLWYRAPDILMGSKKYSTPIDIWSVGCIFAEMVNGRPLFPGASETDQLMRIFKILGTPNSQ 223          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CRK1_SCHPO (Serine/threonine-protein kinase crk1 OS=Schizosaccharomyces pombe GN=crk1 PE=1 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 3.214e-39
Identity = 82/199 (41.21%), Postives = 123/199 (61.81%), Query Frame = 2
Query:    8 VALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLA-SFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            VA+KK++    +        REI  LR   H NVI+L  + +++ +  L ++  +++ DL  L+    + F    +K +M  LL GL H H+  +LHRD+K +NLLI  DGVLK+ADFGL+  F  P+H   M+ +V+T WYRPPEL +G   YG GVD+WS GCI AEL+   P +PG ++++QL+ I++  G+P  E
Sbjct:   37 VAIKKIKVGQFKDGIDISALREIKFLRESRHDNVIELVDVFSTKSN--LNIILEFLDSDLEMLIKDKFIVFQPAHIKSWMVMLLRGLHHIHSRFILHRDLKPNNLLISSDGVLKLADFGLSRDFGTPSH---MSHQVITRWYRPPELFMGCRSYGTGVDMWSVGCIFAELMLRTPYLPGESDLDQLNVIFRALGTPEPE 230          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDKA2_ORYSJ (Cyclin-dependent kinase A-2 OS=Oryza sativa subsp. japonica GN=CDKA-2 PE=2 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 3.214e-39
Identity = 91/201 (45.27%), Postives = 133/201 (66.17%), Query Frame = 2
Query:    8 VALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAG-LVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDD-DGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +ALKK+R +  E E V   A REI +L+ + H N+++L+ +V  +  C +YLVF Y++ DL   + +SP+ K     VK +++Q+L G+ +CH++ VLHRD+K  NLLID     LK+ADFGLA  F    +   T  VVTLWYR PE+LLGA  Y   VD+WS GCI AE++  KP+ PG +E+++L KI+ + G+P+EE
Sbjct:   30 IALKKIRLEQ-EDEGVPSTAIREISLLKEMQHRNIVRLQDVV-HKEKC-IYLVFEYLDLDLKKHMDSSPDFK-NHRIVKSFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLARAFGIPVR-TFTHEVVTLWYRAPEILLGARHYSTPVDMWSVGCIFAEMVNQKPLFPGDSEIDELFKIFSIMGTPNEE 225          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2_ORYCU (Cell division control protein 2 homolog OS=Oryzias curvinotus GN=cdc2 PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 4.198e-39
Identity = 85/202 (42.08%), Postives = 126/202 (62.38%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVAS-PEVKFTEPQ-VKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            ++VA+KK+R ++ E        RE+ +L+ L HPNV++L  L        LYL+F ++  DL   + S P  ++ +P  VK Y++Q+L G+  CH   VLHRD+K  NLLID+ GV+K+ADFGL+  F    +   T  VVTLWYR PE+LLG+  Y   VD+WS G I AEL   KP+  G +E++QL +I++  G+P+ +
Sbjct:   28 QVVAMKKIRLESEEEGVPSTAVREVSLLQELKHPNVVRL--LDVLMQESRLYLIFEFLSMDLKKYLDSIPSGQYMDPMLVKSYLYQILEGIYFCHRRRVLHRDLKPQNLLIDNKGVIKLADFGLSRAFGVPVR-VYTHEVVTLWYRAPEVLLGSPRYSTPVDVWSTGTIFAELATKKPLFHGDSEIDQLFRIFRTLGTPNND 226          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK7_DICDI (Cell division protein kinase 7 OS=Dictyostelium discoideum GN=cdk7 PE=2 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 5.483e-39
Identity = 88/203 (43.35%), Postives = 123/203 (60.59%), Query Frame = 2
Query:    2 KIVALKKVR---FDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSE 598
            +IVA+KK+R     N   + + F A REI IL+ L H NV+ L  +   + +  +YLVF  M+ DL  ++    +      +K YM  LL G+E CH N VLHRD+K +NLL+  +G LK+ADFGLA  +   +K   + + VT++YR PELL GA  YG  VD+WS GCI AEL+   P +PG  E++QL KI    G+P+E
Sbjct:   28 QIVAIKKIRKILIQNQTDDGINFSAIREIKILQELKHDNVVNLLDIFAHKSN--VYLVFELMQWDLQEVIEDKSIILKPADIKSYMKMLLQGIEACHRNWVLHRDLKPNNLLMSINGDLKLADFGLARQYGSPNK-VFSPQAVTIFYRAPELLFGAKSYGPSVDIWSIGCIFAELMLRTPYLPGTGEIDQLRKICSALGTPNE 227          
The following BLAST results are available for this feature:
BLAST of DC900398 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CDC21_MEDSA1.884e-3944.78Cell division control protein 2 homolog 1 (Fragmen... [more]
YP62_CAEEL2.461e-3943.90Putative serine/threonine-protein kinase B0495.2 O... [more]
Y8487_DICDI2.461e-3945.51Probable cyclin-dependent serine/threonine-protein... [more]
CDK20_HUMAN2.461e-3943.28Cell division protein kinase 20 OS=Homo sapiens GN... [more]
CDC2_CHERU2.461e-3944.28Cell division control protein 2 homolog OS=Chenopo... [more]
CDC2H_PLABA2.461e-3941.41Cell division control protein 2 homolog OS=Plasmod... [more]
CRK1_SCHPO3.214e-3941.21Serine/threonine-protein kinase crk1 OS=Schizosacc... [more]
CDKA2_ORYSJ3.214e-3945.27Cyclin-dependent kinase A-2 OS=Oryza sativa subsp.... [more]
CDC2_ORYCU4.198e-3942.08Cell division control protein 2 homolog OS=Oryzias... [more]
CDK7_DICDI5.483e-3943.35Cell division protein kinase 7 OS=Dictyostelium di... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900398 VSS Citrus sinensis cDNA clone VS28972 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900398 ID=DC900398|Name=DC900398|organism=Citrus sinensis|type=EST|length=602bp
CAAAATCGTAGCACTAAAGAAAGTACGGTTTGACAATTTGGAACCTGAGA
GTGTGAAATTTATGGCTAGAGAGATTCTCATATTGCGGAGATTGGATCAT
CCAAATGTTATAAAGTTGGAAGGTTTAGTGACGTCAAGGATGTCATGTAG
TTTGTACCTGGTATTTCATTATATGGAGCATGATTTGGCTGGACTTGTTG
CAAGCCCTGAAGTGAAGTTCACAGAACCACAGGTTAAATGTTACATGCAT
CAACTGCTATCTGGACTTGAGCACTGTCACAACAATGGTGTGCTTCACCG
GGACATTAAAGGCTCTAATCTTCTAATTGATGATGATGGAGTGCTTAAAA
TAGCTGATTTTGGTTTGGCATCTTTCTTTGATCCAAATCATAAGCATCCT
ATGACTAGTCGAGTGGTTACTCTTTGGTATCGACCTCCTGAGCTGCTTCT
GGGGGCTACTGATTACGGTGTGGGTGTTGATCTATGGAGCGCAGGTTGTA
TTTTAGCTGAGCTACTGGCTGGGAAGCCCATTATGCCTGGTCGTACGGAG
GTAGAGCAACTACATAAGATATATAAGTTATGTGGTTCCCCTTCAGAAGA
AT
back to top