DC900390

Overview
NameDC900390
Unique NameDC900390
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length603
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5641 contig Csv1_Contig5641:3..605. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900390 vs. ExPASy Swiss-Prot
Match: NLTP2_ARATH (Non-specific lipid-transfer protein 2 OS=Arabidopsis thaliana GN=LTP2 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 5.713e-12
Identity = 36/93 (38.71%), Postives = 53/93 (56.99%), Query Frame = 2
Query:  110 AAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRY-RGIKLDKARQLPKECGVDIGVPITPDIDCSKI 385
            A ++CG V+  LA C+AYLT     ++ CC GV  LK+   TT DRQ AC+C++ AA     G+   +A  LP  C V+I   I+   +C+ +
Sbjct:   25 ALMSCGTVNGNLAGCIAYLTRGAPLTQGCCNGVTNLKNMASTTPDRQQACRCLQSAAKAVGPGLNTARAAGLPSACKVNIPYKISASTNCNTV 117          
BLAST of DC900390 vs. ExPASy Swiss-Prot
Match: NLTP6_GOSHI (Non-specific lipid-transfer protein 6 OS=Gossypium hirsutum GN=LTP6 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.836e-11
Identity = 39/95 (41.05%), Postives = 49/95 (51.58%), Query Frame = 2
Query:  107 QAAITCGQVDSFLAPCLAYLTGEG-KPSRA-CCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 385
            Q AI+  QV S L PC+ Y+ G   +P+    C G+  LK       DRQAACKCIK  A     I    A  LP +C V I   I+P IDC ++
Sbjct:   25 QGAISYDQVKSSLLPCVGYVRGNNARPAPPNYCKGIRSLKSAARIRLDRQAACKCIKSLAADISDINYGVAAGLPGQCNVHIPYKISPSIDCKRV 119          
The following BLAST results are available for this feature:
BLAST of DC900390 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
NLTP2_ARATH5.713e-1238.71Non-specific lipid-transfer protein 2 OS=Arabidops... [more]
NLTP6_GOSHI2.836e-1141.05Non-specific lipid-transfer protein 6 OS=Gossypium... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900390 VSS Citrus sinensis cDNA clone VS28963 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900390 ID=DC900390|Name=DC900390|organism=Citrus sinensis|type=EST|length=603bp
AAACACCAAACACCTTCAAAATCCTCCAGCATTATTAGAAAACATGAAAG
CCGGTGTGGTTCTTGCTGTGATGTTACTGGCAGCGATCGTCATGGTGGAG
CGAGGCCAGGCAGCTATAACCTGCGGCCAAGTCGACTCCTTTCTAGCTCC
TTGCTTGGCATATCTGACCGGGGAAGGCAAGCCATCTCGGGCATGCTGCA
CTGGTGTCGAGTATCTGAAAGACAACACTCCAACAACTGCAGACAGGCAA
GCTGCTTGTAAATGCATCAAAGATGCGGCAACTCGCTATCGCGGCATCAA
GCTGGACAAAGCTCGTCAACTCCCCAAAGAATGTGGCGTCGACATCGGCG
TTCCCATCACCCCCGATATCGACTGTAGCAAAATTTCTTAGAACCCCCCA
CGGAGGCTTTGAGCTTGTGCGTTGAATAAACATCTCTGCCAGCTGGAGAA
AACACAGCACAATTAATATACATGAGCTAATTAAGCTTGTTAATTTATGC
TGCTTGTTATGGTTCTTGCTGAAGAACTTTTTGTATCGGGATACTTTTAG
TGCATGGTGTTTTAGCACATAATTAGCGTTAATAAAACGAGAGTTATTAC
CTC
back to top