DC900387

Overview
NameDC900387
Unique NameDC900387
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length699
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6745 contig Csv1_Contig6745:1707..2408. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDOA_RAT (Fructose-bisphosphate aldolase A OS=Rattus norvegicus GN=Aldoa PE=1 SV=2)

HSP 1 Score: 128.642 bits (322), Expect = 8.965e-33
Identity = 66/122 (54.10%), Postives = 83/122 (68.03%), Query Frame = 2
Query:   59 KLHRRVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            K     IA  TV AL+RT+P AVP V FLSGGQSEEEA+ NLNA+N+    KPW+L+FS+GRALQ S LKAW GK+EN++ AQ  ++ R  ANS A  G Y    Q G  A+ESL + ++ Y
Sbjct:  243 KFSNEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYIKRALANSLACQGKYTPSGQSGAAASESLFISNHAY 364          

HSP 2 Score: 31.187 bits (69), Expect = 8.965e-33
Identity = 13/13 (100.00%), Postives = 13/13 (100.00%), Query Frame = 1
Query:    7 EGTLLKPNMVTPG 45
            EGTLLKPNMVTPG
Sbjct:  225 EGTLLKPNMVTPG 237          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF_ECHMU (Fructose-bisphosphate aldolase OS=Echinococcus multilocularis GN=FBPA PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.168e-32
Identity = 68/115 (59.13%), Postives = 83/115 (72.17%), Query Frame = 2
Query:   80 AEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            A  TV ALQRT+P AVP VVFLSGGQSE +ATRNLNA+N+   KKPW+LSFSFGRALQ S + AW GK ENV+  QA FL   KAN  A+LG ++G+ +   G  +SL V ++ Y
Sbjct:  250 ARATVEALQRTVPVAVPGVVFLSGGQSELDATRNLNAINKYPGKKPWALSFSFGRALQASAIAAWQGKPENVKAGQAEFLQLAKANGAASLGKFEGELKTAAG-QKSLFVANHAY 363          

HSP 2 Score: 28.8758 bits (63), Expect = 1.168e-32
Identity = 13/18 (72.22%), Postives = 13/18 (72.22%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAPK 60
            EGTLLKPNMVT G    K
Sbjct:  225 EGTLLKPNMVTCGQSCTK 242          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDOC_PANTR (Fructose-bisphosphate aldolase C OS=Pan troglodytes GN=ALDOC PE=2 SV=3)

HSP 1 Score: 121.324 bits (303), Expect = 3.359e-32
Identity = 59/116 (50.86%), Postives = 80/116 (68.97%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            IA  TV AL+RT+P AVP V FLSGGQSEEEA+ NLNA+N+    +PW+L+FS+GRALQ S L AW G+ +N + A   F+ R + N  A  G Y+G  + G  AA+SL++ ++ Y
Sbjct:  249 IAMATVTALRRTVPPAVPGVTFLSGGQSEEEASFNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDNAEAATEEFIKRAEVNGLAAQGKYEGSGEDGGAAAQSLYIANHAY 364          

HSP 2 Score: 36.5798 bits (83), Expect = 3.359e-32
Identity = 18/23 (78.26%), Postives = 18/23 (78.26%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAP-KVTPE 72
            EGTLLKPNMVTPG   P K TPE
Sbjct:  225 EGTLLKPNMVTPGHACPIKYTPE 247          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDOA_PANTR (Fructose-bisphosphate aldolase A OS=Pan troglodytes GN=ALDOA PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 7.418e-32
Identity = 65/122 (53.28%), Postives = 82/122 (67.21%), Query Frame = 2
Query:   59 KLHRRVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            K     IA  TV AL+RT+P AV  + FLSGGQSEEEA+ NLNA+N+    KPW+L+FS+GRALQ S LKAW GK+EN++ AQ  ++ R  ANS A  G Y    Q G  A+ESL V ++ Y
Sbjct:  243 KFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFVSNHAY 364          

HSP 2 Score: 31.187 bits (69), Expect = 7.418e-32
Identity = 13/13 (100.00%), Postives = 13/13 (100.00%), Query Frame = 1
Query:    7 EGTLLKPNMVTPG 45
            EGTLLKPNMVTPG
Sbjct:  225 EGTLLKPNMVTPG 237          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDOA_MOUSE (Fructose-bisphosphate aldolase A OS=Mus musculus GN=Aldoa PE=1 SV=2)

HSP 1 Score: 125.561 bits (314), Expect = 7.418e-32
Identity = 65/122 (53.28%), Postives = 82/122 (67.21%), Query Frame = 2
Query:   59 KLHRRVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            K     IA  TV AL+RT+P AV  V FLSGGQSEEEA+ NLNA+N+    KPW+L+FS+GRALQ S LKAW GK+EN++ AQ  ++ R  ANS A  G Y    Q G  A+ESL + ++ Y
Sbjct:  243 KFSNEEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYIKRALANSLACQGKYTPSGQSGAAASESLFISNHAY 364          

HSP 2 Score: 31.187 bits (69), Expect = 7.418e-32
Identity = 13/13 (100.00%), Postives = 13/13 (100.00%), Query Frame = 1
Query:    7 EGTLLKPNMVTPG 45
            EGTLLKPNMVTPG
Sbjct:  225 EGTLLKPNMVTPG 237          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDOA_HUMAN (Fructose-bisphosphate aldolase A OS=Homo sapiens GN=ALDOA PE=1 SV=2)

HSP 1 Score: 125.561 bits (314), Expect = 7.418e-32
Identity = 65/122 (53.28%), Postives = 82/122 (67.21%), Query Frame = 2
Query:   59 KLHRRVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            K     IA  TV AL+RT+P AV  + FLSGGQSEEEA+ NLNA+N+    KPW+L+FS+GRALQ S LKAW GK+EN++ AQ  ++ R  ANS A  G Y    Q G  A+ESL V ++ Y
Sbjct:  243 KFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFVSNHAY 364          

HSP 2 Score: 31.187 bits (69), Expect = 7.418e-32
Identity = 13/13 (100.00%), Postives = 13/13 (100.00%), Query Frame = 1
Query:    7 EGTLLKPNMVTPG 45
            EGTLLKPNMVTPG
Sbjct:  225 EGTLLKPNMVTPG 237          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDOC_MACFA (Fructose-bisphosphate aldolase C OS=Macaca fascicularis GN=ALDOC PE=2 SV=3)

HSP 1 Score: 120.168 bits (300), Expect = 7.418e-32
Identity = 59/116 (50.86%), Postives = 79/116 (68.10%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            IA  TV AL+RT+P AVP V FLSGGQSEEEA+ NLNA+N+    +PW+L+FS+GRALQ S L AW G+ +N   A   F+ R + N  A  G Y+G  + G  AA+SL++ ++ Y
Sbjct:  249 IAMATVTALRRTVPPAVPGVTFLSGGQSEEEASLNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAAQGKYEGSGEDGGAAAQSLYIANHAY 364          

HSP 2 Score: 36.5798 bits (83), Expect = 7.418e-32
Identity = 18/23 (78.26%), Postives = 18/23 (78.26%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAP-KVTPE 72
            EGTLLKPNMVTPG   P K TPE
Sbjct:  225 EGTLLKPNMVTPGHACPIKYTPE 247          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDOA_RABIT (Fructose-bisphosphate aldolase A OS=Oryctolagus cuniculus GN=ALDOA PE=1 SV=2)

HSP 1 Score: 125.176 bits (313), Expect = 9.659e-32
Identity = 65/122 (53.28%), Postives = 82/122 (67.21%), Query Frame = 2
Query:   59 KLHRRVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            K     IA  TV AL+RT+P AV  V FLSGGQSEEEA+ NLNA+N+    KPW+L+FS+GRALQ S LKAW GK+EN++ AQ  ++ R  ANS A  G Y    Q G  A+ESL + ++ Y
Sbjct:  243 KYSHEEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFISNHAY 364          

HSP 2 Score: 31.187 bits (69), Expect = 9.659e-32
Identity = 13/13 (100.00%), Postives = 13/13 (100.00%), Query Frame = 1
Query:    7 EGTLLKPNMVTPG 45
            EGTLLKPNMVTPG
Sbjct:  225 EGTLLKPNMVTPG 237          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDOC_HUMAN (Fructose-bisphosphate aldolase C OS=Homo sapiens GN=ALDOC PE=1 SV=2)

HSP 1 Score: 119.783 bits (299), Expect = 9.659e-32
Identity = 59/116 (50.86%), Postives = 79/116 (68.10%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            IA  TV AL+RT+P AVP V FLSGGQSEEEA+ NLNA+N+    +PW+L+FS+GRALQ S L AW G+ +N   A   F+ R + N  A  G Y+G  + G  AA+SL++ ++ Y
Sbjct:  249 IAMATVTALRRTVPPAVPGVTFLSGGQSEEEASFNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAAQGKYEGSGEDGGAAAQSLYIANHAY 364          

HSP 2 Score: 36.5798 bits (83), Expect = 9.659e-32
Identity = 18/23 (78.26%), Postives = 18/23 (78.26%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAP-KVTPE 72
            EGTLLKPNMVTPG   P K TPE
Sbjct:  225 EGTLLKPNMVTPGHACPIKYTPE 247          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF_DICDI (Fructose-bisphosphate aldolase OS=Dictyostelium discoideum GN=fba PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.639e-31
Identity = 67/116 (57.76%), Postives = 82/116 (70.69%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            I + TVR LQRT+P A+  VVFLSGGQ+E EAT NLNAMN L  + PW+LSFS+GRALQ S +  W G+  NV+ A+  +L R K NS A LG Y G+   G  A+ESL+VKDYKY
Sbjct:  244 IGKFTVRTLQRTVPPALTGVVFLSGGQTEIEATANLNAMNVLPNR-PWALSFSYGRALQASVISTWKGESANVEAARKVYLHRAKCNSLAQLGKYTGEESTG-SASESLYVKDYKY 357          

HSP 2 Score: 28.4906 bits (62), Expect = 1.639e-31
Identity = 14/23 (60.87%), Postives = 16/23 (69.57%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAP-KVTPE 72
            EG LLKPNMV  G++ P K T E
Sbjct:  220 EGALLKPNMVVNGTDCPIKATSE 242          
The following BLAST results are available for this feature:
BLAST of DC900387 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 58
Match NameE-valueIdentityDescription
ALDOA_RAT8.965e-3354.10Fructose-bisphosphate aldolase A OS=Rattus norvegi... [more]
ALF_ECHMU1.168e-3259.13Fructose-bisphosphate aldolase OS=Echinococcus mul... [more]
ALDOC_PANTR3.359e-3250.86Fructose-bisphosphate aldolase C OS=Pan troglodyte... [more]
ALDOA_PANTR7.418e-3253.28Fructose-bisphosphate aldolase A OS=Pan troglodyte... [more]
ALDOA_MOUSE7.418e-3253.28Fructose-bisphosphate aldolase A OS=Mus musculus G... [more]
ALDOA_HUMAN7.418e-3253.28Fructose-bisphosphate aldolase A OS=Homo sapiens G... [more]
ALDOC_MACFA7.418e-3250.86Fructose-bisphosphate aldolase C OS=Macaca fascicu... [more]
ALDOA_RABIT9.659e-3253.28Fructose-bisphosphate aldolase A OS=Oryctolagus cu... [more]
ALDOC_HUMAN9.659e-3250.86Fructose-bisphosphate aldolase C OS=Homo sapiens G... [more]
ALF_DICDI1.639e-3157.76Fructose-bisphosphate aldolase OS=Dictyostelium di... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900387 VSS Citrus sinensis cDNA clone VS28960 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900387 ID=DC900387|Name=DC900387|organism=Citrus sinensis|type=EST|length=699bp
CCCTCTGAGGGTACCCTTTTGAAGCCCAACATGGTGACCCCTGGATCTGA
AGCTCCCAAAGTTACACCGGAGGGTGATTGCTGAACACACTGTCCGGGCC
CTGCAACGCACTATGCCTGCAGCAGTTCCTGCTGTTGTGTTCTTGTCTGG
TGGGCAGAGTGAGGAGGAGGCTACCCGCAACCTTAATGCCATGAACCAGC
TCAAGACGAAGAAGCCATGGTCACTTTCCTTTTCCTTTGGACGTGCACTT
CAGCAGAGCACTCTCAAGGCATGGGCTGGAAAGGAAGAGAATGTGCAGAA
GGCCCAGGCTGCTTTCCTTGTCAGGTGCAAGGCCAACTCTGAGGCTACCC
TCGGTACTTACAAGGGCGATGCCCAGCTTGGTGAAGGTGCCGCAGAGTCT
CTCCATGTCAAGGACTACAAATACTAAGCACAGTTGAAGCTTTGGGTGTT
GTGCTTTATGAACTTTATGAGAGTAAATGGCGGTATGAACATTAGGTTGG
CACATTCTCATTCATAGTTTTAGGGCTTTTTCATATTAGGTGGAGCAATA
AAAAGCTTGGGAACTTCGGTTTGAGTGGTTTTGATCAAAACTAAACTGAA
AACTGTTTATGCTTTTGTTTTTGTTTTTTTTTTCCTTTTCCCCTAATGGC
GCTAAATTTCTGTGATTTTGTCACATAATTGATAATGTTTTCTTGTGCT
back to top