DC900387

Overview
NameDC900387
Unique NameDC900387
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length699
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6745 contig Csv1_Contig6745:1707..2408. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDOA_PONAB (Fructose-bisphosphate aldolase A OS=Pongo abelii GN=ALDOA PE=2 SV=3)

HSP 1 Score: 124.02 bits (310), Expect = 2.133e-31
Identity = 64/122 (52.46%), Postives = 81/122 (66.39%), Query Frame = 2
Query:   59 KLHRRVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            K     I   TV AL+RT+P AV  + FLSGGQSEEEA+ NLNA+N+    KPW+L+FS+GRALQ S LKAW GK+EN++ AQ  ++ R  ANS A  G Y    Q G  A+ESL V ++ Y
Sbjct:  243 KFSHEEIVMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFVSNHAY 364          

HSP 2 Score: 31.187 bits (69), Expect = 2.133e-31
Identity = 13/13 (100.00%), Postives = 13/13 (100.00%), Query Frame = 1
Query:    7 EGTLLKPNMVTPG 45
            EGTLLKPNMVTPG
Sbjct:  225 EGTLLKPNMVTPG 237          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF_DROME (Fructose-bisphosphate aldolase OS=Drosophila melanogaster GN=Ald PE=1 SV=5)

HSP 1 Score: 118.242 bits (295), Expect = 2.778e-31
Identity = 65/117 (55.56%), Postives = 81/117 (69.23%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTY-KGDAQLGEGAAESLHVKDYKY 424
            IA  TV+AL+RT+PAAV  V FLSGGQSEEEAT NL+A+N +   +PW+L+FS+GRALQ S L+AWAGK+EN+   Q   L R KAN +A  G Y  G A  G G   SL V ++ Y
Sbjct:  248 IALATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFSYGRALQASVLRAWAGKKENIAAGQNELLKRAKANGDAAQGKYVAGSAGAGSG---SLFVANHAY 361          

HSP 2 Score: 36.5798 bits (83), Expect = 2.778e-31
Identity = 17/22 (77.27%), Postives = 17/22 (77.27%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAPKVTPE 72
            EGTLLKPNMVT G  A K TPE
Sbjct:  225 EGTLLKPNMVTAGQSAKKNTPE 246          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALFC1_ARATH (Probable fructose-bisphosphate aldolase 1, chloroplastic OS=Arabidopsis thaliana GN=FBA1 PE=1 SV=2)

HSP 1 Score: 120.553 bits (301), Expect = 6.126e-31
Identity = 63/116 (54.31%), Postives = 78/116 (67.24%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            +A +T++ L+  +P AVP ++FLSGGQSE EAT NLNAMNQ     PW +SFS+ RALQ + LK W GKEENV+ AQ   L R KANS A LG Y G+ +  E A E + VK Y Y
Sbjct:  287 VASYTLKLLRNRIPPAVPGIMFLSGGQSELEATLNLNAMNQ--APNPWHVSFSYARALQNTCLKTWGGKEENVKAAQDILLARAKANSLAQLGKYTGEGE-SEEAKEGMFVKGYTY 399          

HSP 2 Score: 33.113 bits (74), Expect = 6.126e-31
Identity = 16/23 (69.57%), Postives = 19/23 (82.61%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEA-PKVTPE 72
            EG LLKP+MVTPG+EA  + TPE
Sbjct:  263 EGILLKPSMVTPGAEATDRATPE 285          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDOB_SPAAU (Fructose-bisphosphate aldolase B OS=Sparus aurata GN=aldob PE=2 SV=2)

HSP 1 Score: 117.472 bits (293), Expect = 7.987e-31
Identity = 57/116 (49.14%), Postives = 76/116 (65.52%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            +A  TV AL+RT+PA+VP + FLSGGQSEEEA+ +LNA+NQ+   +PW L+FS+GRALQ S L AW GK+ N    Q  F+ R K N  A+ G YK      + + +SL+   Y Y
Sbjct:  249 VAMATVTALRRTVPASVPGICFLSGGQSEEEASIHLNAINQVPLHRPWKLTFSYGRALQASALAAWQGKDANKAATQQVFVTRAKINGLASKGEYKPSGSADQASQQSLYTASYVY 364          

HSP 2 Score: 35.8094 bits (81), Expect = 7.987e-31
Identity = 17/23 (73.91%), Postives = 18/23 (78.26%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAP-KVTPE 72
            EGTLLKPNMVTPG   P K TP+
Sbjct:  225 EGTLLKPNMVTPGHSCPKKFTPQ 247          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDOB_CHICK (Fructose-bisphosphate aldolase B OS=Gallus gallus GN=ALDOB PE=3 SV=3)

HSP 1 Score: 120.168 bits (300), Expect = 1.040e-30
Identity = 63/116 (54.31%), Postives = 73/116 (62.93%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            +A  TV  L RT+PAAVP + FLSGGQSEEEA+ NLNAMNQ    KPW L+FS+GRALQ S L AW GK EN + AQ AF  R + NS A  G Y    +    A +SL    Y Y
Sbjct:  249 VAVATVTTLLRTVPAAVPGICFLSGGQSEEEASLNLNAMNQSPLPKPWKLTFSYGRALQASALAAWLGKSENKKAAQEAFCKRAQINSLACRGQYVTSGKTDTAATQSLFTASYTY 364          

HSP 2 Score: 32.7278 bits (73), Expect = 1.040e-30
Identity = 16/23 (69.57%), Postives = 17/23 (73.91%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAP-KVTPE 72
            EGTLLKPNMVT G   P K TP+
Sbjct:  225 EGTLLKPNMVTAGHSCPKKYTPQ 247          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALFC_ORYSJ (Fructose-bisphosphate aldolase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os11g0171300 PE=1 SV=2)

HSP 1 Score: 120.939 bits (302), Expect = 1.353e-30
Identity = 62/116 (53.45%), Postives = 81/116 (69.83%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            ++++T++ L R +P AVP ++FLSGGQSE EAT+NLNAMNQ     PW +SFS+ RALQ + LK W G+ ENV+ AQ A L+R KANS A LG Y  D +  E A E + VK+Y Y
Sbjct:  276 VSDYTLKLLHRRIPPAVPGIMFLSGGQSEVEATQNLNAMNQ--GPNPWHVSFSYARALQNTCLKTWGGQPENVKAAQDALLLRAKANSLAQLGKYTSDGEAAE-AKEGMFVKNYVY 388          

HSP 2 Score: 31.5722 bits (70), Expect = 1.353e-30
Identity = 15/23 (65.22%), Postives = 18/23 (78.26%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEA-PKVTPE 72
            EG LLKP+MVTPG+E   + TPE
Sbjct:  252 EGILLKPSMVTPGAECKDRATPE 274          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF1_LAMJA (Fructose-bisphosphate aldolase, muscle type OS=Lampetra japonica PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.354e-30
Identity = 61/116 (52.59%), Postives = 82/116 (70.69%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            +A  T+ AL+RT+P AVP + FLSGGQSEE+A+ +LNA+N+L   KPW+L+FS+GRALQ S LKAW GK+EN++ AQ   + R K N +A+ G YK     G  A ESL V ++ Y
Sbjct:  249 VAMATLTALRRTVPPAVPGITFLSGGQSEEDASIHLNAINKLHLIKPWALTFSYGRALQASVLKAWGGKKENLKAAQDELMRRAKINGQASKGEYK-PTGTGAAAGESLFVANHAY 363          

HSP 2 Score: 32.7278 bits (73), Expect = 1.354e-30
Identity = 15/20 (75.00%), Postives = 16/20 (80.00%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAPKVT 66
            EGTLLKPNMVT G+ AP  T
Sbjct:  225 EGTLLKPNMVTVGTAAPAST 244          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF_PLAFA (Fructose-bisphosphate aldolase OS=Plasmodium falciparum PE=1 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 1.763e-30
Identity = 67/112 (59.82%), Postives = 80/112 (71.43%), Query Frame = 2
Query:   89 TVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            TVR L+RT+P A+P VVFLSGGQSEEEA+ NLN++N L    PW+L+FS+GRALQ S L  W GK+ENV KA+   L R +ANS AT G YKG A  GE A  SL+ K Y Y
Sbjct:  260 TVRTLRRTVPPALPGVVFLSGGQSEEEASVNLNSINALGPH-PWALTFSYGRALQASVLNTWQGKKENVAKAREVLLQRAEANSLATYGKYKGGAG-GENAGASLYEKKYVY 369          

HSP 2 Score: 28.4906 bits (62), Expect = 1.763e-30
Identity = 14/24 (58.33%), Postives = 14/24 (58.33%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAPKVTPEGD 78
            EG LLKPNMVT G E    T   D
Sbjct:  232 EGALLKPNMVTAGYECTAKTTTQD 255          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF_PLAF7 (Fructose-bisphosphate aldolase OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0425 PE=3 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 1.763e-30
Identity = 67/112 (59.82%), Postives = 80/112 (71.43%), Query Frame = 2
Query:   89 TVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            TVR L+RT+P A+P VVFLSGGQSEEEA+ NLN++N L    PW+L+FS+GRALQ S L  W GK+ENV KA+   L R +ANS AT G YKG A  GE A  SL+ K Y Y
Sbjct:  260 TVRTLRRTVPPALPGVVFLSGGQSEEEASVNLNSINALGPH-PWALTFSYGRALQASVLNTWQGKKENVAKAREVLLQRAEANSLATYGKYKGGAG-GENAGASLYEKKYVY 369          

HSP 2 Score: 28.4906 bits (62), Expect = 1.763e-30
Identity = 14/24 (58.33%), Postives = 14/24 (58.33%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAPKVTPEGD 78
            EG LLKPNMVT G E    T   D
Sbjct:  232 EGALLKPNMVTAGYECTAKTTTQD 255          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDOC_RAT (Fructose-bisphosphate aldolase C OS=Rattus norvegicus GN=Aldoc PE=1 SV=3)

HSP 1 Score: 116.701 bits (291), Expect = 2.297e-30
Identity = 60/116 (51.72%), Postives = 78/116 (67.24%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            IA  TV AL+RT+P AVP V FLSGGQSEEEA+ NLNA+N+    +PW+L+FS+GRALQ S L AW G+ +N   A   F+ R + N  A  G Y+G    G  AA+SL+V ++ Y
Sbjct:  249 IAMATVTALRRTVPPAVPGVTFLSGGQSEEEASLNLNAINRCSLPRPWALTFSYGRALQASALSAWRGQRDNAGAATEEFIKRAEMNGLAAQGKYEGSGD-GGAAAQSLYVANHAY 363          

HSP 2 Score: 35.039 bits (79), Expect = 2.297e-30
Identity = 17/23 (73.91%), Postives = 18/23 (78.26%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAP-KVTPE 72
            EGTLLKPNMVTPG   P K +PE
Sbjct:  225 EGTLLKPNMVTPGHACPIKYSPE 247          
The following BLAST results are available for this feature:
BLAST of DC900387 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 58
Match NameE-valueIdentityDescription
ALDOA_PONAB2.133e-3152.46Fructose-bisphosphate aldolase A OS=Pongo abelii G... [more]
ALF_DROME2.778e-3155.56Fructose-bisphosphate aldolase OS=Drosophila melan... [more]
ALFC1_ARATH6.126e-3154.31Probable fructose-bisphosphate aldolase 1, chlorop... [more]
ALDOB_SPAAU7.987e-3149.14Fructose-bisphosphate aldolase B OS=Sparus aurata ... [more]
ALDOB_CHICK1.040e-3054.31Fructose-bisphosphate aldolase B OS=Gallus gallus ... [more]
ALFC_ORYSJ1.353e-3053.45Fructose-bisphosphate aldolase, chloroplastic OS=O... [more]
ALF1_LAMJA1.354e-3052.59Fructose-bisphosphate aldolase, muscle type OS=Lam... [more]
ALF_PLAFA1.763e-3059.82Fructose-bisphosphate aldolase OS=Plasmodium falci... [more]
ALF_PLAF71.763e-3059.82Fructose-bisphosphate aldolase OS=Plasmodium falci... [more]
ALDOC_RAT2.297e-3051.72Fructose-bisphosphate aldolase C OS=Rattus norvegi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900387 VSS Citrus sinensis cDNA clone VS28960 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900387 ID=DC900387|Name=DC900387|organism=Citrus sinensis|type=EST|length=699bp
CCCTCTGAGGGTACCCTTTTGAAGCCCAACATGGTGACCCCTGGATCTGA
AGCTCCCAAAGTTACACCGGAGGGTGATTGCTGAACACACTGTCCGGGCC
CTGCAACGCACTATGCCTGCAGCAGTTCCTGCTGTTGTGTTCTTGTCTGG
TGGGCAGAGTGAGGAGGAGGCTACCCGCAACCTTAATGCCATGAACCAGC
TCAAGACGAAGAAGCCATGGTCACTTTCCTTTTCCTTTGGACGTGCACTT
CAGCAGAGCACTCTCAAGGCATGGGCTGGAAAGGAAGAGAATGTGCAGAA
GGCCCAGGCTGCTTTCCTTGTCAGGTGCAAGGCCAACTCTGAGGCTACCC
TCGGTACTTACAAGGGCGATGCCCAGCTTGGTGAAGGTGCCGCAGAGTCT
CTCCATGTCAAGGACTACAAATACTAAGCACAGTTGAAGCTTTGGGTGTT
GTGCTTTATGAACTTTATGAGAGTAAATGGCGGTATGAACATTAGGTTGG
CACATTCTCATTCATAGTTTTAGGGCTTTTTCATATTAGGTGGAGCAATA
AAAAGCTTGGGAACTTCGGTTTGAGTGGTTTTGATCAAAACTAAACTGAA
AACTGTTTATGCTTTTGTTTTTGTTTTTTTTTTCCTTTTCCCCTAATGGC
GCTAAATTTCTGTGATTTTGTCACATAATTGATAATGTTTTCTTGTGCT
back to top