DC900387

Overview
NameDC900387
Unique NameDC900387
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length699
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6745 contig Csv1_Contig6745:1707..2408. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDOB_BOVIN (Fructose-bisphosphate aldolase B OS=Bos taurus GN=ALDOB PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 2.990e-30
Identity = 62/116 (53.45%), Postives = 73/116 (62.93%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            +A  TV AL RT+PAAVP + FLSGG SEE+AT NLNA+N     KPW LSFS+GRALQ S L AW GK EN +  Q AF+ R  ANS+A  G Y      G  + +SL    Y Y
Sbjct:  249 VAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAENKKTTQEAFMKRALANSQAAKGQYVHMGSSGSASTQSLFTASYTY 364          

HSP 2 Score: 30.4166 bits (67), Expect = 2.990e-30
Identity = 16/23 (69.57%), Postives = 16/23 (69.57%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSE-APKVTPE 72
            EGTLLKPNMVT G     K TPE
Sbjct:  225 EGTLLKPNMVTAGHACTKKYTPE 247          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDOC_MOUSE (Fructose-bisphosphate aldolase C OS=Mus musculus GN=Aldoc PE=1 SV=4)

HSP 1 Score: 115.931 bits (289), Expect = 3.894e-30
Identity = 59/116 (50.86%), Postives = 78/116 (67.24%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            IA  TV AL+RT+P AVP V FLSGGQSEEEA+ NLNA+N+    +PW+L+FS+GRALQ S L AW G+ +N   A   F+ R + N  A  G Y+G    G  AA+SL++ ++ Y
Sbjct:  249 IAMATVTALRRTVPPAVPGVTFLSGGQSEEEASLNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEMNGLAAQGRYEGSGD-GGAAAQSLYIANHAY 363          

HSP 2 Score: 35.039 bits (79), Expect = 3.894e-30
Identity = 17/23 (73.91%), Postives = 18/23 (78.26%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAP-KVTPE 72
            EGTLLKPNMVTPG   P K +PE
Sbjct:  225 EGTLLKPNMVTPGHACPIKYSPE 247          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALFC1_PEA (Fructose-bisphosphate aldolase 1, chloroplastic (Fragment) OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 5.071e-30
Identity = 64/116 (55.17%), Postives = 78/116 (67.24%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            +AE+T+  L R +P AVP ++FLSGGQSE EAT NLNAMN  K+  PW +SFS+ RALQ + LK W G  ENV+ AQ A L R K+NS A LG Y GD +  E A + L VK Y Y
Sbjct:  244 VAEYTLNLLHRRIPPAVPGIMFLSGGQSEVEATLNLNAMN--KSPNPWHVSFSYARALQNTALKTWGGLPENVKAAQEALLFRAKSNSLAQLGKYYGDGE-SEEAKKELFVKGYSY 356          

HSP 2 Score: 29.6462 bits (65), Expect = 5.071e-30
Identity = 12/16 (75.00%), Postives = 15/16 (93.75%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEA 54
            EG LLKP+MVTPG+E+
Sbjct:  220 EGILLKPSMVTPGAES 235          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALFC2_ARATH (Probable fructose-bisphosphate aldolase 2, chloroplastic OS=Arabidopsis thaliana GN=FBA2 PE=1 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 8.583e-30
Identity = 61/116 (52.59%), Postives = 76/116 (65.52%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            +A +T++ L+  +P AVP ++FLSGGQSE EAT NLNAMNQ     PW +SFS+ RALQ + LK W G+ ENV  AQ   L R KANS A LG Y G+ +  E A E + VK Y Y
Sbjct:  286 VAAYTLKLLRNRVPPAVPGIMFLSGGQSEVEATLNLNAMNQ--APNPWHVSFSYARALQNTCLKTWGGRPENVNAAQTTLLARAKANSLAQLGKYTGEGE-SEEAKEGMFVKGYTY 398          

HSP 2 Score: 31.9574 bits (71), Expect = 8.583e-30
Identity = 15/23 (65.22%), Postives = 19/23 (82.61%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEA-PKVTPE 72
            EG LLKP+MVTPG+E+  + TPE
Sbjct:  262 EGILLKPSMVTPGAESKDRATPE 284          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDOB_MOUSE (Fructose-bisphosphate aldolase B OS=Mus musculus GN=Aldob PE=1 SV=3)

HSP 1 Score: 118.627 bits (296), Expect = 1.457e-29
Identity = 60/116 (51.72%), Postives = 72/116 (62.07%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            +A  TV AL RT+PAAVP + FLSGG SEE+AT NLNA+N+    +PW LSFS+GRALQ S L AW GK  N +  Q AF+ R  AN +A  G Y      G  A +SL    Y Y
Sbjct:  249 VAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINRCPLPRPWKLSFSYGRALQASALAAWGGKAANKKATQEAFMKRAMANCQAAQGQYVHTGSSGAAATQSLFTASYTY 364          

HSP 2 Score: 30.4166 bits (67), Expect = 1.457e-29
Identity = 16/23 (69.57%), Postives = 16/23 (69.57%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSE-APKVTPE 72
            EGTLLKPNMVT G     K TPE
Sbjct:  225 EGTLLKPNMVTAGHACTKKYTPE 247          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDOB_SHEEP (Fructose-bisphosphate aldolase B OS=Ovis aries GN=ALDOB PE=2 SV=2)

HSP 1 Score: 118.242 bits (295), Expect = 1.897e-29
Identity = 61/116 (52.59%), Postives = 72/116 (62.07%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            +A  TV AL RT+PAAVP + FLSGG SEE+AT NLNA+N     KPW LSFS+GRALQ S L AW GK EN +  Q AF+ R  ANS+A  G Y         + +SL    Y Y
Sbjct:  249 VAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAENKKATQEAFMKRALANSQAAKGQYVHMGSSDSASTQSLFTASYTY 364          

HSP 2 Score: 30.4166 bits (67), Expect = 1.897e-29
Identity = 16/23 (69.57%), Postives = 16/23 (69.57%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSE-APKVTPE 72
            EGTLLKPNMVT G     K TPE
Sbjct:  225 EGTLLKPNMVTAGHACTKKYTPE 247          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDOB_RABIT (Fructose-bisphosphate aldolase B OS=Oryctolagus cuniculus GN=ALDOB PE=1 SV=3)

HSP 1 Score: 117.857 bits (294), Expect = 2.470e-29
Identity = 60/116 (51.72%), Postives = 71/116 (61.21%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            +A  TV AL RT+PAAVP + FLSGG SEE+AT NLNA+N     KPW LSFS+GRALQ S L AW GK EN +  Q AF+ R   N +A  G Y      G  + +SL    Y Y
Sbjct:  249 VAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAENKKATQEAFMKRAVVNCQAAKGQYVHTGSSGAASTQSLFTASYTY 364          

HSP 2 Score: 30.4166 bits (67), Expect = 2.470e-29
Identity = 16/23 (69.57%), Postives = 16/23 (69.57%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSE-APKVTPE 72
            EGTLLKPNMVT G     K TPE
Sbjct:  225 EGTLLKPNMVTAGHACTKKYTPE 247          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALFC3_ARATH (Probable fructose-bisphosphate aldolase 3, chloroplastic OS=Arabidopsis thaliana GN=FBA3 PE=1 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 3.212e-29
Identity = 61/122 (50.00%), Postives = 79/122 (64.75%), Query Frame = 2
Query:   59 KLHRRVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            K     +A+ T+  L+R +P AVP ++FLSGGQSE EAT NLNAMNQ  +  PW +SFS+ RALQ S L+ W GK E ++ +Q A LVR KANS A LG Y  + +  E A + + VK Y Y
Sbjct:  273 KASPETVADFTLTMLKRRVPPAVPGIMFLSGGQSEAEATLNLNAMNQ--SPNPWHVSFSYARALQNSVLRTWQGKPEKIEASQKALLVRAKANSLAQLGKYSAEGE-NEDAKKGMFVKGYTY 391          

HSP 2 Score: 30.4166 bits (67), Expect = 3.212e-29
Identity = 15/23 (65.22%), Postives = 18/23 (78.26%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSE-APKVTPE 72
            EG LLKP+MVTPG+E   K +PE
Sbjct:  255 EGILLKPSMVTPGAEHKNKASPE 277          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF2_LAMJA (Fructose-bisphosphate aldolase, non-muscle type OS=Lampetra japonica PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 5.451e-29
Identity = 60/116 (51.72%), Postives = 78/116 (67.24%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            +A  TV AL+RT+P+AVP + FLSGGQSEE+A+ NLNA+NQL  ++PW+LSFS+GRALQ S LKAWAG   N+  A+  F  R   N  A  G Y      G  A+ESL + ++ Y
Sbjct:  249 VAMATVTALRRTVPSAVPGITFLSGGQSEEDASLNLNAINQLPLERPWALSFSYGRALQASVLKAWAGAPANIPAAKKEFEKRAAINGLAAQGKYVPAGSSGSAASESLFIANHNY 364          

HSP 2 Score: 26.9498 bits (58), Expect = 5.451e-29
Identity = 13/19 (68.42%), Postives = 16/19 (84.21%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAPKV 63
            EG+LLKPNMVT G +A K+
Sbjct:  225 EGSLLKPNMVTAG-QASKI 242          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDOB_HUMAN (Fructose-bisphosphate aldolase B OS=Homo sapiens GN=ALDOB PE=1 SV=2)

HSP 1 Score: 116.701 bits (291), Expect = 5.451e-29
Identity = 60/116 (51.72%), Postives = 71/116 (61.21%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            +A  TV AL RT+PAAVP + FLSGG SEE+AT NLNA+N     KPW LSFS+GRALQ S L AW GK  N +  Q AF+ R  AN +A  G Y      G  + +SL    Y Y
Sbjct:  249 VAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSGAASTQSLFTACYTY 364          

HSP 2 Score: 30.4166 bits (67), Expect = 5.451e-29
Identity = 16/23 (69.57%), Postives = 16/23 (69.57%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSE-APKVTPE 72
            EGTLLKPNMVT G     K TPE
Sbjct:  225 EGTLLKPNMVTAGHACTKKYTPE 247          
The following BLAST results are available for this feature:
BLAST of DC900387 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 58
Match NameE-valueIdentityDescription
ALDOB_BOVIN2.990e-3053.45Fructose-bisphosphate aldolase B OS=Bos taurus GN=... [more]
ALDOC_MOUSE3.894e-3050.86Fructose-bisphosphate aldolase C OS=Mus musculus G... [more]
ALFC1_PEA5.071e-3055.17Fructose-bisphosphate aldolase 1, chloroplastic (F... [more]
ALFC2_ARATH8.583e-3052.59Probable fructose-bisphosphate aldolase 2, chlorop... [more]
ALDOB_MOUSE1.457e-2951.72Fructose-bisphosphate aldolase B OS=Mus musculus G... [more]
ALDOB_SHEEP1.897e-2952.59Fructose-bisphosphate aldolase B OS=Ovis aries GN=... [more]
ALDOB_RABIT2.470e-2951.72Fructose-bisphosphate aldolase B OS=Oryctolagus cu... [more]
ALFC3_ARATH3.212e-2950.00Probable fructose-bisphosphate aldolase 3, chlorop... [more]
ALF2_LAMJA5.451e-2951.72Fructose-bisphosphate aldolase, non-muscle type OS... [more]
ALDOB_HUMAN5.451e-2951.72Fructose-bisphosphate aldolase B OS=Homo sapiens G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900387 VSS Citrus sinensis cDNA clone VS28960 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900387 ID=DC900387|Name=DC900387|organism=Citrus sinensis|type=EST|length=699bp
CCCTCTGAGGGTACCCTTTTGAAGCCCAACATGGTGACCCCTGGATCTGA
AGCTCCCAAAGTTACACCGGAGGGTGATTGCTGAACACACTGTCCGGGCC
CTGCAACGCACTATGCCTGCAGCAGTTCCTGCTGTTGTGTTCTTGTCTGG
TGGGCAGAGTGAGGAGGAGGCTACCCGCAACCTTAATGCCATGAACCAGC
TCAAGACGAAGAAGCCATGGTCACTTTCCTTTTCCTTTGGACGTGCACTT
CAGCAGAGCACTCTCAAGGCATGGGCTGGAAAGGAAGAGAATGTGCAGAA
GGCCCAGGCTGCTTTCCTTGTCAGGTGCAAGGCCAACTCTGAGGCTACCC
TCGGTACTTACAAGGGCGATGCCCAGCTTGGTGAAGGTGCCGCAGAGTCT
CTCCATGTCAAGGACTACAAATACTAAGCACAGTTGAAGCTTTGGGTGTT
GTGCTTTATGAACTTTATGAGAGTAAATGGCGGTATGAACATTAGGTTGG
CACATTCTCATTCATAGTTTTAGGGCTTTTTCATATTAGGTGGAGCAATA
AAAAGCTTGGGAACTTCGGTTTGAGTGGTTTTGATCAAAACTAAACTGAA
AACTGTTTATGCTTTTGTTTTTGTTTTTTTTTTCCTTTTCCCCTAATGGC
GCTAAATTTCTGTGATTTTGTCACATAATTGATAATGTTTTCTTGTGCT
back to top