DC900387

Overview
NameDC900387
Unique NameDC900387
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length699
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6745 contig Csv1_Contig6745:1707..2408. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF_LYMST (Fructose-bisphosphate aldolase (Fragment) OS=Lymnaea stagnalis PE=3 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 7.492e-25
Identity = 48/71 (67.61%), Postives = 56/71 (78.87%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEE 289
            IA  TV AL RT+PAAV  + FLSGGQSEE+AT NLNA+NQ   +KPW L+FS+GRALQ S LKAW GK+E
Sbjct:   30 IARATVTALNRTVPAAVAGITFLSGGQSEEDATINLNAINQFPGRKPWPLTFSYGRALQASVLKAWGGKDE 100          

HSP 2 Score: 33.4982 bits (75), Expect = 7.492e-25
Identity = 17/23 (73.91%), Postives = 17/23 (73.91%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAP-KVTPE 72
            EGTLLKPNMVT G   P K TPE
Sbjct:    6 EGTLLKPNMVTAGQGCPKKYTPE 28          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF1_XYLFA (Probable fructose-bisphosphate aldolase class 1 OS=Xylella fastidiosa GN=XF_0826 PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 9.450e-21
Identity = 50/98 (51.02%), Postives = 66/98 (67.35%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWA-GKEENVQKAQAAFLVRCKANSEATLGTYKG 367
            +AE TV  L+ T+PA +P +VFLSGGQ++ ++T +LNAMNQL    PW LSFS+GRA+QQ+ LK W+   + N  KAQ     R K N  A LG +KG
Sbjct:  238 VAESTVMCLKSTVPAILPGIVFLSGGQTDAQSTAHLNAMNQL-DPLPWPLSFSYGRAMQQAALKLWSQDMKGNFAKAQQVVYERAKENGLAALGKWKG 334          

HSP 2 Score: 24.2534 bits (51), Expect = 9.450e-21
Identity = 9/15 (60.00%), Postives = 13/15 (86.67%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSE 51
            EGT+LK +MV PG++
Sbjct:  214 EGTILKASMVIPGTD 228          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF1_XYLFT (Probable fructose-bisphosphate aldolase class 1 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=PD_1845 PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 2.705e-20
Identity = 49/98 (50.00%), Postives = 65/98 (66.33%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWA-GKEENVQKAQAAFLVRCKANSEATLGTYKG 367
            +AE TV  L+ T+PA +P +VFLSGGQ++ ++T +LNAMNQ     PW LSFS+GRA+QQ+ LK W+   + N  KAQ     R K N  A LG +KG
Sbjct:  238 VAESTVMCLKSTVPAILPGIVFLSGGQTDAQSTAHLNAMNQF-DPLPWPLSFSYGRAMQQAALKLWSQDMKGNFAKAQQVVYERAKENGLAALGKWKG 334          

HSP 2 Score: 24.2534 bits (51), Expect = 2.705e-20
Identity = 9/15 (60.00%), Postives = 13/15 (86.67%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSE 51
            EGT+LK +MV PG++
Sbjct:  214 EGTILKASMVIPGTD 228          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF1_XANAC (Probable fructose-bisphosphate aldolase class 1 OS=Xanthomonas axonopodis pv. citri GN=XAC3344 PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 6.398e-19
Identity = 50/98 (51.02%), Postives = 65/98 (66.33%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWA-GKEENVQKAQAAFLVRCKANSEATLGTYKG 367
            +AE TV  L+ T+PA +P +VFLSGGQ++E++T +LN M+QL    PW LSFS+GRA+QQ+ LK WA     N  KAQ     R K N  A LG +KG
Sbjct:  238 VAESTVMCLKSTVPAILPGIVFLSGGQTDEQSTAHLNEMHQL-GNLPWPLSFSYGRAMQQAALKLWAKDMTGNFAKAQQVIYERAKENGLAALGKWKG 334          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALFC_CHLRE (Fructose-bisphosphate aldolase 1, chloroplastic OS=Chlamydomonas reinhardtii GN=ALDCHL PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.808e-18
Identity = 51/116 (43.97%), Postives = 69/116 (59.48%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            +AE+T++ L    P  VP ++FLSGGQSE E+T NLNAMNQ  +  PW +SFS+ RAL  + LK W      VQ  + A   R KANS+A  G Y    + G+ AA+ ++ K   Y
Sbjct:  262 VAEYTLKMLAARAPP-VPGIMFLSGGQSELESTLNLNAMNQ--SPNPWHVSFSYARALTNTVLKTWQASPRTVQAPRLAAQAR-KANSDAQQGKYDATTE-GKEAAQGMYEKGKGY 372          

HSP 2 Score: 25.7942 bits (55), Expect = 1.808e-18
Identity = 10/15 (66.67%), Postives = 13/15 (86.67%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSE 51
            +G LLKP MVTPG++
Sbjct:  238 QGILLKPAMVTPGAD 252          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF1_XANCP (Probable fructose-bisphosphate aldolase class 1 OS=Xanthomonas campestris pv. campestris GN=XCC3185 PE=3 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.862e-18
Identity = 49/98 (50.00%), Postives = 65/98 (66.33%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWA-GKEENVQKAQAAFLVRCKANSEATLGTYKG 367
            +AE TV  L+ T+PA +P +VFLSGGQ++E++T +LN M+QL    PW LSFS+GRA+QQ+ LK W+     N  KAQ     R K N  A LG +KG
Sbjct:  238 VAESTVMCLKSTVPAILPGIVFLSGGQTDEQSTAHLNEMHQL-GNLPWPLSFSYGRAMQQAALKLWSKDMTGNYAKAQQIIYERAKENGLAALGKWKG 334          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALFC_SPIOL (Fructose-bisphosphate aldolase, chloroplastic OS=Spinacia oleracea PE=1 SV=3)

HSP 1 Score: 85.5001 bits (210), Expect = 6.710e-18
Identity = 47/103 (45.63%), Postives = 63/103 (61.17%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGE 385
            +A++ ++ L R     VP ++ LSGGQSE EAT NLNAMNQ  +  PW +SFS+ RALQ + LK W   +ENV+    A     K+NS A LG Y G+ +  E
Sbjct:  284 VADYPLKLLHRRRGPVVPGIMVLSGGQSEVEATLNLNAMNQ--SPNPWHVSFSYARALQNTCLKTWVEGQENVKAQDFAC---AKSNSLAQLGKYTGEGESEE 381          

HSP 2 Score: 24.2534 bits (51), Expect = 6.710e-18
Identity = 13/23 (56.52%), Postives = 16/23 (69.57%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGS-EAPKVTPE 72
            EG+ LKP+MV PG+  A K  PE
Sbjct:  260 EGSSLKPSMVGPGALSARKGPPE 282          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF_ENCCU (Fructose-bisphosphate aldolase OS=Encephalitozoon cuniculi GN=ECU01_0240 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.130e-14
Identity = 37/81 (45.68%), Postives = 51/81 (62.96%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFL 319
            +A  T+RAL  T+P  +P +VFLSGG   E+A   LNA+N  +  + WSLSFSF RAL    L+ W G + N+++AQ   L
Sbjct:  240 VATFTLRALLSTIPCGIPGIVFLSGGHGSEDAIGFLNAINMERGCRTWSLSFSFARALTDGVLETWRGDDSNIEEAQKILL 320          
The following BLAST results are available for this feature:
BLAST of DC900387 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 58
Match NameE-valueIdentityDescription
ALF_LYMST7.492e-2567.61Fructose-bisphosphate aldolase (Fragment) OS=Lymna... [more]
ALF1_XYLFA9.450e-2151.02Probable fructose-bisphosphate aldolase class 1 OS... [more]
ALF1_XYLFT2.705e-2050.00Probable fructose-bisphosphate aldolase class 1 OS... [more]
ALF1_XANAC6.398e-1951.02Probable fructose-bisphosphate aldolase class 1 OS... [more]
ALFC_CHLRE1.808e-1843.97Fructose-bisphosphate aldolase 1, chloroplastic OS... [more]
ALF1_XANCP1.862e-1850.00Probable fructose-bisphosphate aldolase class 1 OS... [more]
ALFC_SPIOL6.710e-1845.63Fructose-bisphosphate aldolase, chloroplastic OS=S... [more]
ALF_ENCCU2.130e-1445.68Fructose-bisphosphate aldolase OS=Encephalitozoon ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900387 VSS Citrus sinensis cDNA clone VS28960 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900387 ID=DC900387|Name=DC900387|organism=Citrus sinensis|type=EST|length=699bp
CCCTCTGAGGGTACCCTTTTGAAGCCCAACATGGTGACCCCTGGATCTGA
AGCTCCCAAAGTTACACCGGAGGGTGATTGCTGAACACACTGTCCGGGCC
CTGCAACGCACTATGCCTGCAGCAGTTCCTGCTGTTGTGTTCTTGTCTGG
TGGGCAGAGTGAGGAGGAGGCTACCCGCAACCTTAATGCCATGAACCAGC
TCAAGACGAAGAAGCCATGGTCACTTTCCTTTTCCTTTGGACGTGCACTT
CAGCAGAGCACTCTCAAGGCATGGGCTGGAAAGGAAGAGAATGTGCAGAA
GGCCCAGGCTGCTTTCCTTGTCAGGTGCAAGGCCAACTCTGAGGCTACCC
TCGGTACTTACAAGGGCGATGCCCAGCTTGGTGAAGGTGCCGCAGAGTCT
CTCCATGTCAAGGACTACAAATACTAAGCACAGTTGAAGCTTTGGGTGTT
GTGCTTTATGAACTTTATGAGAGTAAATGGCGGTATGAACATTAGGTTGG
CACATTCTCATTCATAGTTTTAGGGCTTTTTCATATTAGGTGGAGCAATA
AAAAGCTTGGGAACTTCGGTTTGAGTGGTTTTGATCAAAACTAAACTGAA
AACTGTTTATGCTTTTGTTTTTGTTTTTTTTTTCCTTTTCCCCTAATGGC
GCTAAATTTCTGTGATTTTGTCACATAATTGATAATGTTTTCTTGTGCT
back to top