DC900386

Overview
NameDC900386
Unique NameDC900386
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length652
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6745 contig Csv1_Contig6745:1022..1673. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALFC_ORYSJ (Fructose-bisphosphate aldolase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os11g0171300 PE=1 SV=2)

HSP 1 Score: 214.157 bits (544), Expect = 4.909e-55
Identity = 111/185 (60.00%), Postives = 134/185 (72.43%), Query Frame = 2
Query:   26 SITMSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            +++M    G Y DEL+K A  I +PG+GILA DES  T GKRL+SI +EN E+NR+A R LL   PG  QY+SG ILFEETLYQ T  GK  VD+L E  ++PGIKVDKG V LAG+N E+  QGLDGLA R   YY+ GARFAKWR V+ I PN PS+LA+ E A GLARYA I Q+NGLVP++
Sbjct:   31 TVSMVVRAGAYDDELVKTAKTIASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTVDGKKIVDILTEQKIVPGIKVDKGLVPLAGSNNESWCQGLDGLASREAAYYQQGARFAKWRTVVSI-PNGPSELAVKEAAWGLARYAAISQDNGLVPIV 214          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF1_LAMJA (Fructose-bisphosphate aldolase, muscle type OS=Lampetra japonica PE=2 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 1.094e-54
Identity = 108/173 (62.43%), Postives = 131/173 (75.72%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCT-PGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            EL   A  I   GKGILAADES GT+GKRL+ I +EN + +RR  R+LLF T P   +++ G+I F ET+YQKT  G PFV ++K+ G+L GIKVDKG V LAGTNGE TTQGLDGLA+RC +Y + GA FAKWR VLKI PN PS+L+I ENAN LARYA ICQ+NGLVP++
Sbjct:   15 ELADIAQRIVASGKGILAADESVGTMGKRLTQIGLENTDEHRRFYRQLLFTTDPSIKEHIGGIIFFHETMYQKTDGGVPFVKLVKDNGILVGIKVDKGVVPLAGTNGEGTTQGLDGLAERCAQYKKDGADFAKWRCVLKISPNTPSRLSIVENANVLARYATICQQNGLVPIV 187          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALFC2_PEA (Fructose-bisphosphate aldolase 2, chloroplastic OS=Pisum sativum PE=1 SV=2)

HSP 1 Score: 210.69 bits (535), Expect = 5.428e-54
Identity = 109/177 (61.58%), Postives = 128/177 (72.32%), Query Frame = 2
Query:   50 GKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            G YADEL+K A  I +PG+GILA DES  T GKRL SI +EN E+NR+A R LL   P   +Y+SG ILFEETLYQ T  G+  VDVL E  ++PGIKVDKG V LAG+N E+  QGLDGLA R   YY+ GARFAKWR V+ I PN PS LA+ E A GLARYA I Q+NGLVP++
Sbjct:    1 GSYADELVKTAKTIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAWRTLLVTVPTLGEYISGAILFEETLYQSTVDGRKIVDVLVEQNIIPGIKVDKGLVPLAGSNNESWCQGLDGLASRSAAYYQQGARFAKWRTVVSI-PNGPSALAVKEAAWGLARYAAISQDNGLVPIV 176          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALFC_SPIOL (Fructose-bisphosphate aldolase, chloroplastic OS=Spinacia oleracea PE=1 SV=3)

HSP 1 Score: 210.305 bits (534), Expect = 7.089e-54
Identity = 111/191 (58.12%), Postives = 135/191 (70.68%), Query Frame = 2
Query:    8 KFSIFKSITMSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            +F+   S +++     YADEL+K A  + +PG+GILA DES  T GKRL+SI +EN E+NR+A R LL   PG  QY+SG ILFEETLYQ T  GK  VDVL E G++PGIKVDKG + L G+N E+  QGLDGLA R   YY+ GARFAKWR V+ I PN PS LA+ E A GLARYA I Q+NGL P+L
Sbjct:   33 RFTPSGSSSLTVRASSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLISAPGLGQYVSGAILFEETLYQSTTDGKKMVDVLIEQGIVPGIKVDKGWLPLPGSNDESWCQGLDGLACRSAAYYQQGARFAKWRTVVSI-PNGPSALAVKEAAWGLARYAAITQDNGLDPIL 222          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALFC2_ARATH (Probable fructose-bisphosphate aldolase 2, chloroplastic OS=Arabidopsis thaliana GN=FBA2 PE=1 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 1.579e-53
Identity = 108/175 (61.71%), Postives = 127/175 (72.57%), Query Frame = 2
Query:   56 YADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            YADEL+K A  I +PG+GILA DES  T GKRL SI +EN E+NR+A R LL   PG  QY+SG ILFEETLYQ T  GK  VDVL E  ++PGIKVDKG V L G+N E+  QGLDGL+ R   YY+ GARFAKWR V+ I PN PS LA+ E A GLARYA I Q++GLVP++
Sbjct:   51 YADELVKTAKTIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAFRTLLVSAPGLGQYVSGAILFEETLYQSTTEGKKMVDVLVEQNIVPGIKVDKGLVPLVGSNNESWGQGLDGLSSRTAAYYQQGARFAKWRTVVSI-PNGPSALAVKEAAWGLARYAAISQDSGLVPIV 224          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALFC1_PEA (Fructose-bisphosphate aldolase 1, chloroplastic (Fragment) OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 1.579e-53
Identity = 109/177 (61.58%), Postives = 128/177 (72.32%), Query Frame = 2
Query:   50 GKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            G YADEL+K A  I +PG+GILA DES  T GKRL+SI +EN E NR+A R LL   P   +Y+SG ILFEETLYQ T  G+  VDVL E  ++PGIKVDKG V LAG+N E+  QGLDGLA R   YY+ GARFAKWR V+ I PN PS LA+ E A GLARYA I Q+NGLVP++
Sbjct:    7 GSYADELVKTAKTIASPGRGILAMDESNATCGKRLASIGLENTEVNRQAWRTLLVTVPTLGEYISGAILFEETLYQSTTDGRKIVDVLIEQNIIPGIKVDKGLVPLAGSNDESWCQGLDGLASRSAAYYQQGARFAKWRTVVSI-PNGPSALAVKEAAWGLARYAAISQDNGLVPIV 182          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALFC3_ARATH (Probable fructose-bisphosphate aldolase 3, chloroplastic OS=Arabidopsis thaliana GN=FBA3 PE=1 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 2.063e-53
Identity = 106/177 (59.89%), Postives = 130/177 (73.45%), Query Frame = 2
Query:   50 GKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            G Y+DEL+K A  I +PG+GILA DES  T GKRL+SI ++N E NR+A R+LL  TPG   Y+SG ILFEETLYQ T  GK FVD L++  ++PGIKVDKG   LAG+N E+  QGLDGLA R  +YY+ GARFAKWR V+ + P  PS LA+ E A GLARYA I Q+NGLVP++
Sbjct:   42 GAYSDELVKTAKSIASPGRGILAIDESNATCGKRLASIGLDNTEDNRQAYRQLLLTTPGLGDYISGSILFEETLYQSTKDGKTFVDCLRDANIVPGIKVDKGLSPLAGSNEESWCQGLDGLASRSAEYYKQGARFAKWRTVVSV-PCGPSALAVKEAAWGLARYAAISQDNGLVPIV 217          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDOB_CHICK (Fructose-bisphosphate aldolase B OS=Gallus gallus GN=ALDOB PE=3 SV=3)

HSP 1 Score: 208.379 bits (529), Expect = 2.694e-53
Identity = 107/168 (63.69%), Postives = 127/168 (75.60%), Query Frame = 2
Query:   80 AAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGAL-QYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            A  I   GKGILAADES GT+G RL  INVEN E NRRA RE+LF +  ++ + + GVILF ETLYQK ++GKPF  ++KE G++ GIK+D GT  LAGTNGETT QGLD LA+RC +Y + GA F KWRAVLKI    PSQLAI ENAN LARYA ICQ+NGLVP++
Sbjct:   20 AQRIVASGKGILAADESVGTMGNRLQRINVENTEENRRAFREILFSSDASISKSIGGVILFHETLYQKDSSGKPFPAIIKEKGMVVGIKLDAGTAPLAGTNGETTIQGLDKLAERCAQYKKDGADFGKWRAVLKISSTTPSQLAIQENANTLARYASICQQNGLVPIV 187          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALFC1_ARATH (Probable fructose-bisphosphate aldolase 1, chloroplastic OS=Arabidopsis thaliana GN=FBA1 PE=1 SV=2)

HSP 1 Score: 205.297 bits (521), Expect = 2.280e-52
Identity = 107/175 (61.14%), Postives = 126/175 (72.00%), Query Frame = 2
Query:   56 YADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            YADEL+K A  I +PG GI+A DES  T GKRL+SI +EN E+NR+A R LL   PG  QY+SG ILFEETLYQ T  GK  VDVL E  ++PGIKVDKG V L G+  E+  QGLDGLA R   YY+ GARFAKWR V+ I PN PS LA+ E A GLARYA I Q++GLVP++
Sbjct:   52 YADELVKTAKTIASPGHGIMAMDESNATCGKRLASIGLENTEANRQAYRTLLVSAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLVGSYDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI-PNGPSALAVKEAAWGLARYAAISQDSGLVPIV 225          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDOC_CARAU (Fructose-bisphosphate aldolase C OS=Carassius auratus GN=aldoc PE=2 SV=2)

HSP 1 Score: 204.912 bits (520), Expect = 2.978e-52
Identity = 106/173 (61.27%), Postives = 128/173 (73.99%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGAL-QYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            EL   A  I  PGKGILAADESTG++ KRL+ I VEN E NRR  R+LLF     + + + GVI F ETLYQK   G PF  ++K+ G++ GIKVDKG V LAGTNGETTTQGLDGL++RC +Y + GA FAKWR+VLKI    PS+LAI ENAN LARYA ICQ+NG+VP++
Sbjct:   15 ELQDIAQRIVAPGKGILAADESTGSMAKRLNPIGVENTEENRRLYRQLLFTADERMDKCIGGVIFFHETLYQKADDGTPFAKMIKDRGIVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRSVLKISETSPSELAIMENANVLARYASICQQNGIVPIV 187          
The following BLAST results are available for this feature:
BLAST of DC900386 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
ALFC_ORYSJ4.909e-5560.00Fructose-bisphosphate aldolase, chloroplastic OS=O... [more]
ALF1_LAMJA1.094e-5462.43Fructose-bisphosphate aldolase, muscle type OS=Lam... [more]
ALFC2_PEA5.428e-5461.58Fructose-bisphosphate aldolase 2, chloroplastic OS... [more]
ALFC_SPIOL7.089e-5458.12Fructose-bisphosphate aldolase, chloroplastic OS=S... [more]
ALFC2_ARATH1.579e-5361.71Probable fructose-bisphosphate aldolase 2, chlorop... [more]
ALFC1_PEA1.579e-5361.58Fructose-bisphosphate aldolase 1, chloroplastic (F... [more]
ALFC3_ARATH2.063e-5359.89Probable fructose-bisphosphate aldolase 3, chlorop... [more]
ALDOB_CHICK2.694e-5363.69Fructose-bisphosphate aldolase B OS=Gallus gallus ... [more]
ALFC1_ARATH2.280e-5261.14Probable fructose-bisphosphate aldolase 1, chlorop... [more]
ALDOC_CARAU2.978e-5261.27Fructose-bisphosphate aldolase C OS=Carassius aura... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900386 VSS Citrus sinensis cDNA clone VS28960 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900386 ID=DC900386|Name=DC900386|organism=Citrus sinensis|type=EST|length=652bp
ACAAAACAAATTTTCTATCTTCAAGTCGATCACCATGTCTTGCTTCAAGG
GCAAATACGCCGATGAGCTCATTAAAAATGCTGCCTACATTGGCACCCCT
GGAAAGGGTATCCTTGCTGCTGATGAGTCAACAGGCACCATTGGCAAGCG
TCTATCCAGCATCAATGTTGAGAATGTTGAGTCAAACAGGCGTGCTCTCC
GCGAGCTCCTTTTCTGCACTCCCGGTGCCCTTCAGTACCTCAGTGGTGTC
ATCCTCTTCGAGGAGACCCTCTACCAGAAGACTGCTGCTGGCAAGCCCTT
TGTTGATGTCTTGAAGGAGGGTGGAGTCCTCCCTGGAATTAAGGTTGACA
AGGGTACTGTTGAGCTTGCTGGTACCAATGGTGAGACCACCACCCAGGGT
CTTGATGGCCTCGCCCAGCGCTGCCAGAAATACTATGAAGCTGGTGCTCG
TTTTGCCAAATGGCGTGCTGTTCTTAAGATTGGCCCTAATGAGCCTTCGC
AGCTGGCCATCAATGAGAATGCCAATGGCCTGGCCCGATATGCTATCATC
TGCCAGGAGAATGGCCTTGTTCCATTGTTGACCTGAGATCCTTGNTGCGG
CCCATGCATCACAGTGTGCTGTGTACCGAGCGTGTCTGCTGATCTCAGCT
TA
back to top