DC900386

Overview
NameDC900386
Unique NameDC900386
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length652
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6745 contig Csv1_Contig6745:1022..1673. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDOA_RAT (Fructose-bisphosphate aldolase A OS=Rattus norvegicus GN=Aldoa PE=1 SV=2)

HSP 1 Score: 204.912 bits (520), Expect = 2.978e-52
Identity = 109/173 (63.01%), Postives = 125/173 (72.25%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQ-YLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            EL   A  I  PGKGILAADESTG+I KRL SI  EN E NRR  R+LL      +   + GVILF ETLYQK   G+PF  V+K  G + GIKVDKG V LAGTNGETTTQGLDGL++RC +Y + GA FAKWR VLKIG + PS LAI ENAN LARYA ICQ+NG+VP++
Sbjct:   15 ELADIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSSLAIMENANVLARYASICQQNGIVPIV 187          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDOA_RABIT (Fructose-bisphosphate aldolase A OS=Oryctolagus cuniculus GN=ALDOA PE=1 SV=2)

HSP 1 Score: 204.142 bits (518), Expect = 5.080e-52
Identity = 109/173 (63.01%), Postives = 125/173 (72.25%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQ-YLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            EL   A  I  PGKGILAADESTG+I KRL SI  EN E NRR  R+LL      +   + GVILF ETLYQK   G+PF  V+K  G + GIKVDKG V LAGTNGETTTQGLDGL++RC +Y + GA FAKWR VLKIG + PS LAI ENAN LARYA ICQ+NG+VP++
Sbjct:   15 ELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIV 187          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDOA_PONAB (Fructose-bisphosphate aldolase A OS=Pongo abelii GN=ALDOA PE=2 SV=3)

HSP 1 Score: 204.142 bits (518), Expect = 5.080e-52
Identity = 109/173 (63.01%), Postives = 125/173 (72.25%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQ-YLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            EL   A  I  PGKGILAADESTG+I KRL SI  EN E NRR  R+LL      +   + GVILF ETLYQK   G+PF  V+K  G + GIKVDKG V LAGTNGETTTQGLDGL++RC +Y + GA FAKWR VLKIG + PS LAI ENAN LARYA ICQ+NG+VP++
Sbjct:   15 ELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIV 187          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDOA_MOUSE (Fructose-bisphosphate aldolase A OS=Mus musculus GN=Aldoa PE=1 SV=2)

HSP 1 Score: 204.142 bits (518), Expect = 5.080e-52
Identity = 109/173 (63.01%), Postives = 125/173 (72.25%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQ-YLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            EL   A  I  PGKGILAADESTG+I KRL SI  EN E NRR  R+LL      +   + GVILF ETLYQK   G+PF  V+K  G + GIKVDKG V LAGTNGETTTQGLDGL++RC +Y + GA FAKWR VLKIG + PS LAI ENAN LARYA ICQ+NG+VP++
Sbjct:   15 ELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIV 187          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDOA_HUMAN (Fructose-bisphosphate aldolase A OS=Homo sapiens GN=ALDOA PE=1 SV=2)

HSP 1 Score: 204.142 bits (518), Expect = 5.080e-52
Identity = 109/173 (63.01%), Postives = 125/173 (72.25%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQ-YLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            EL   A  I  PGKGILAADESTG+I KRL SI  EN E NRR  R+LL      +   + GVILF ETLYQK   G+PF  V+K  G + GIKVDKG V LAGTNGETTTQGLDGL++RC +Y + GA FAKWR VLKIG + PS LAI ENAN LARYA ICQ+NG+VP++
Sbjct:   15 ELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIV 187          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDOA_PANTR (Fructose-bisphosphate aldolase A OS=Pan troglodytes GN=ALDOA PE=2 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 1.132e-51
Identity = 109/172 (63.37%), Postives = 124/172 (72.09%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQ-YLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPL 577
            EL   A  I  PGKGILAADESTG+I KRL SI  EN E NRR  R+LL      +   + GVILF ETLYQK   G+PF  V+K  G + GIKVDKG V LAGTNGETTTQGLDGL++RC +Y + GA FAKWR VLKIG + PS LAI ENAN LARYA ICQ+NG+VP+
Sbjct:   15 ELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIVGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPI 186          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDOB_DANRE (Fructose-bisphosphate aldolase B OS=Danio rerio GN=aldob PE=2 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 1.931e-51
Identity = 106/173 (61.27%), Postives = 127/173 (73.41%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGAL-QYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            EL   A  I  PGKGILAADESTGT+ KR   INVEN E NRR+ R+LLF    ++ + + GVILF ETLYQK+  G  F  V+K+ G++ GIKVDKGT  LAGT+GETTTQGLDGL++RC +Y + G  FAKWR VLKI  + PS L I ENAN LARYA ICQ+NGLVP++
Sbjct:   15 ELATIAERIVAPGKGILAADESTGTMAKRFQKINVENTEENRRSFRDLLFSVDDSISESIGGVILFHETLYQKSDKGVLFPKVIKDKGIVVGIKVDKGTAGLAGTDGETTTQGLDGLSERCAQYKKDGCDFAKWRCVLKISDSCPSALGIAENANVLARYASICQQNGLVPIV 187          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF_SCHMA (Fructose-bisphosphate aldolase OS=Schistosoma mansoni PE=2 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 3.293e-51
Identity = 107/174 (61.49%), Postives = 127/174 (72.99%), Query Frame = 2
Query:   62 DELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGAL-QYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            ++L + A  I  PGKGILAADEST T+GKRL  I VEN E NRR  R+LLF     L + +SGVILFEETL+QK+  GK    +L E  ++PGIKVDKG V LAGT+ ETTTQGLD LA RC +Y+  G RFAKWR VLKI  + PS LA+ ENAN LARYA ICQ+NGLVP++
Sbjct:   14 NDLRRIAQAICAPGKGILAADESTATMGKRLQQIGVENNEENRRLYRQLLFSADHKLAENISGVILFEETLHQKSDDGKTLPTLLAERNIIPGIKVDKGVVPLAGTDNETTTQGLDDLASRCAEYWRLGCRFAKWRCVLKISSHTPSYLAMLENANVLARYASICQQNGLVPIV 187          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDCB_DANRE (Fructose-bisphosphate aldolase C-B OS=Danio rerio GN=aldocb PE=2 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 3.293e-51
Identity = 105/173 (60.69%), Postives = 127/173 (73.41%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGAL-QYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            EL   A  I  PGKGILAADESTG++ KRL+ I VEN E NRR  R+LLF     + + + GVI F ETLYQ T  G  F  ++K+ G++ GIKVDKG V LAGTNGETTTQGLDGL++RC +Y + GA FAKWR+VLKI    PS+LAI ENAN LARYA ICQ+NG+VP++
Sbjct:   15 ELQDIAQRIVAPGKGILAADESTGSMAKRLNPIGVENTEENRRLYRQLLFSADERIDKCIGGVIFFHETLYQNTDDGTNFAQLIKDRGIVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRSVLKISDTTPSELAIMENANVLARYASICQQNGIVPIV 187          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDOB_SPAAU (Fructose-bisphosphate aldolase B OS=Sparus aurata GN=aldob PE=2 SV=2)

HSP 1 Score: 201.06 bits (510), Expect = 4.301e-51
Identity = 105/173 (60.69%), Postives = 126/173 (72.83%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGAL-QYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            EL   A  I  PGKGILAADESTGT+GKR  +INVEN+E NRR  R++LF T  ++   + G+I F ETLYQK++ GK F  V+KE G++ GIKVDKGT  L GT+ ETTTQGLDGL++RC +Y + G  FAKWR VLKI    P  LAI ENAN LARYA ICQ NGLVP++
Sbjct:   15 ELSDIAQRIVAPGKGILAADESTGTMGKRFQNINVENIEENRRCFRDILFSTDASIANCVGGIIFFHETLYQKSSNGKLFPQVVKEKGIVVGIKVDKGTAPLMGTDKETTTQGLDGLSERCAQYKKDGCDFAKWRCVLKISDGCPFALAIAENANVLARYASICQMNGLVPIV 187          
The following BLAST results are available for this feature:
BLAST of DC900386 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
ALDOA_RAT2.978e-5263.01Fructose-bisphosphate aldolase A OS=Rattus norvegi... [more]
ALDOA_RABIT5.080e-5263.01Fructose-bisphosphate aldolase A OS=Oryctolagus cu... [more]
ALDOA_PONAB5.080e-5263.01Fructose-bisphosphate aldolase A OS=Pongo abelii G... [more]
ALDOA_MOUSE5.080e-5263.01Fructose-bisphosphate aldolase A OS=Mus musculus G... [more]
ALDOA_HUMAN5.080e-5263.01Fructose-bisphosphate aldolase A OS=Homo sapiens G... [more]
ALDOA_PANTR1.132e-5163.37Fructose-bisphosphate aldolase A OS=Pan troglodyte... [more]
ALDOB_DANRE1.931e-5161.27Fructose-bisphosphate aldolase B OS=Danio rerio GN... [more]
ALF_SCHMA3.293e-5161.49Fructose-bisphosphate aldolase OS=Schistosoma mans... [more]
ALDCB_DANRE3.293e-5160.69Fructose-bisphosphate aldolase C-B OS=Danio rerio ... [more]
ALDOB_SPAAU4.301e-5160.69Fructose-bisphosphate aldolase B OS=Sparus aurata ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900386 VSS Citrus sinensis cDNA clone VS28960 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900386 ID=DC900386|Name=DC900386|organism=Citrus sinensis|type=EST|length=652bp
ACAAAACAAATTTTCTATCTTCAAGTCGATCACCATGTCTTGCTTCAAGG
GCAAATACGCCGATGAGCTCATTAAAAATGCTGCCTACATTGGCACCCCT
GGAAAGGGTATCCTTGCTGCTGATGAGTCAACAGGCACCATTGGCAAGCG
TCTATCCAGCATCAATGTTGAGAATGTTGAGTCAAACAGGCGTGCTCTCC
GCGAGCTCCTTTTCTGCACTCCCGGTGCCCTTCAGTACCTCAGTGGTGTC
ATCCTCTTCGAGGAGACCCTCTACCAGAAGACTGCTGCTGGCAAGCCCTT
TGTTGATGTCTTGAAGGAGGGTGGAGTCCTCCCTGGAATTAAGGTTGACA
AGGGTACTGTTGAGCTTGCTGGTACCAATGGTGAGACCACCACCCAGGGT
CTTGATGGCCTCGCCCAGCGCTGCCAGAAATACTATGAAGCTGGTGCTCG
TTTTGCCAAATGGCGTGCTGTTCTTAAGATTGGCCCTAATGAGCCTTCGC
AGCTGGCCATCAATGAGAATGCCAATGGCCTGGCCCGATATGCTATCATC
TGCCAGGAGAATGGCCTTGTTCCATTGTTGACCTGAGATCCTTGNTGCGG
CCCATGCATCACAGTGTGCTGTGTACCGAGCGTGTCTGCTGATCTCAGCT
TA
back to top