DC900386

Overview
NameDC900386
Unique NameDC900386
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length652
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6745 contig Csv1_Contig6745:1022..1673. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDCA_DANRE (Fructose-bisphosphate aldolase C-A OS=Danio rerio GN=aldoca PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 2.609e-48
Identity = 99/173 (57.23%), Postives = 123/173 (71.10%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQY-LSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            EL + A  I +PGKGILAADES G++GKRL+ I VEN E NRR  R++LF     +   + GVI F ETLYQ +  G PFV ++K+ G+  GIKVDKG V L GTNGET TQGLDGL++RC +Y + GA FAKWR V+KI    PS L I ENA  LARYA ICQ++G+VP++
Sbjct:   15 ELHEIALRIVSPGKGILAADESIGSMGKRLNQIGVENNEENRRLFRQVLFTADDRIDNCIGGVIFFHETLYQNSDDGVPFVKMIKDKGITIGIKVDKGVVPLPGTNGETATQGLDGLSERCAQYKKDGADFAKWRCVMKISETTPSNLCITENAKVLARYASICQQHGIVPIV 187          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF_PLAFA (Fructose-bisphosphate aldolase OS=Plasmodium falciparum PE=1 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 9.915e-48
Identity = 105/193 (54.40%), Postives = 134/193 (69.43%), Query Frame = 2
Query:   59 ADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKI--GPNEPSQLAINENANGLARYAIICQENGLVPLLT*DPXC-GP-CITVCCV 625
            A+EL   A  +   GKGILAADEST TI KR  +I +EN   NR + R+LLF T G  +++SG ILFEETL+QK  AG P V++L    ++PGIKVDKG V +  T+ E +TQGLDGLA+RC++YY+AGARFAKWR VL I     +P+ L+I+E A GLARYA ICQ+N LVP++  +    GP  I VC V
Sbjct:   19 AEELATTAQKLVQAGKGILAADESTQTIKKRFDNIKLENTIENRASYRDLLFGTKGLGKFISGAILFEETLFQKNEAGVPMVNLLHNENIIPGIKVDKGLVNIPCTDEEKSTQGLDGLAERCKEYYKAGARFAKWRTVLVIDTAKGKPTDLSIHETAWGLARYASICQQNRLVPIVEPEILADGPHSIEVCAV 211          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF_PLAF7 (Fructose-bisphosphate aldolase OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0425 PE=3 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 9.915e-48
Identity = 105/193 (54.40%), Postives = 134/193 (69.43%), Query Frame = 2
Query:   59 ADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKI--GPNEPSQLAINENANGLARYAIICQENGLVPLLT*DPXC-GP-CITVCCV 625
            A+EL   A  +   GKGILAADEST TI KR  +I +EN   NR + R+LLF T G  +++SG ILFEETL+QK  AG P V++L    ++PGIKVDKG V +  T+ E +TQGLDGLA+RC++YY+AGARFAKWR VL I     +P+ L+I+E A GLARYA ICQ+N LVP++  +    GP  I VC V
Sbjct:   19 AEELATTAQKLVQAGKGILAADESTQTIKKRFDNIKLENTIENRASYRDLLFGTKGLGKFISGAILFEETLFQKNEAGVPMVNLLHNENIIPGIKVDKGLVNIPCTDEEKSTQGLDGLAERCKEYYKAGARFAKWRTVLVIDTAKGKPTDLSIHETAWGLARYASICQQNRLVPIVEPEILADGPHSIEVCAV 211          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALFC_CHLRE (Fructose-bisphosphate aldolase 1, chloroplastic OS=Chlamydomonas reinhardtii GN=ALDCHL PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.870e-46
Identity = 104/180 (57.78%), Postives = 123/180 (68.33%), Query Frame = 2
Query:   41 CFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            C  GKY +ELIK A  + + G+GILA DES  T GKRL SI VEN E NRRA RELL   PG  QY+SG ILFEETLYQ TA+GK FVDV+KE  ++PGIKVDKG V    T   +   GLDG     + YY+AGARFAKWR+V+ I P+ PS + +   A GLARYA I Q  GLVP++
Sbjct:   25 CAPGKYDEELIKTAGTVASKGRGILAMDESNATCGKRLDSIGVENTEENRRAYRELLVTAPGLGQYISGAILFEETLYQSTASGKKFVDVMKEQNIVPGIKVDKGLVP-CPTPTMSWCMGLDGWTSAAE-YYKAGARFAKWRSVVSI-PHGPS-IMLPRLAYGLARYAAIAQNAGLVPIV 200          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF_TRYBB (Fructose-bisphosphate aldolase, glycosomal OS=Trypanosoma brucei brucei GN=ALD PE=1 SV=2)

HSP 1 Score: 156.762 bits (395), Expect = 9.302e-38
Identity = 86/179 (48.04%), Postives = 107/179 (59.78%), Query Frame = 2
Query:   47 KGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELA-GTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            K  Y  ELI+ A  +  PGKG+LAADESTG+  KR + I + N   +RR  R L+    G  QY+SGVIL +ET+YQK   G+ F   L+  GV+PGIK D G   L  G  GE  T GLDG  +R +KYY  G RF KWR V KI     S+  +  NA  LARYAI+ Q  GLVP++
Sbjct:   19 KTPYEAELIETAKKMTAPGKGLLAADESTGSCSKRFAGIGLSNTAEHRRQYRALMLECEGFEQYISGVILHDETVYQKAKTGETFPQYLRRRGVVPGIKTDCGLEPLVEGAKGEQMTAGLDGYIKRAKKYYAMGCRFCKWRNVYKIQNGTVSEAVVRFNAETLARYAILSQLCGLVPIV 197          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF_ENCCU (Fructose-bisphosphate aldolase OS=Encephalitozoon cuniculi GN=ECU01_0240 PE=1 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 9.009e-33
Identity = 73/160 (45.62%), Postives = 102/160 (63.75%), Query Frame = 2
Query:  101 GKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            GKGILAADE+  T+G+R   + + N E NRR  RE+LF T G  +Y+ GVIL +ET  Q + +G P  ++LK+ G+  GIK+DKG ++      E  + GL+ L  RC+      A FAKWR++       PS+  INEN + LA+YAIICQ+NGLVP++
Sbjct:   21 GKGILAADETPKTLGRRFEKLGITNTEENRRKFREILFSTKGIERYIGGVILNQETFEQTSGSGVPLTELLKKKGIEIGIKLDKGLIDY--KEKEKISVGLEDLDLRCKSSAFKDATFAKWRSLFYFYDGIPSEDCINENCSILAKYAIICQKNGLVPIV 178          
The following BLAST results are available for this feature:
BLAST of DC900386 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
ALDCA_DANRE2.609e-4857.23Fructose-bisphosphate aldolase C-A OS=Danio rerio ... [more]
ALF_PLAFA9.915e-4854.40Fructose-bisphosphate aldolase OS=Plasmodium falci... [more]
ALF_PLAF79.915e-4854.40Fructose-bisphosphate aldolase OS=Plasmodium falci... [more]
ALFC_CHLRE1.870e-4657.78Fructose-bisphosphate aldolase 1, chloroplastic OS... [more]
ALF_TRYBB9.302e-3848.04Fructose-bisphosphate aldolase, glycosomal OS=Tryp... [more]
ALF_ENCCU9.009e-3345.63Fructose-bisphosphate aldolase OS=Encephalitozoon ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900386 VSS Citrus sinensis cDNA clone VS28960 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900386 ID=DC900386|Name=DC900386|organism=Citrus sinensis|type=EST|length=652bp
ACAAAACAAATTTTCTATCTTCAAGTCGATCACCATGTCTTGCTTCAAGG
GCAAATACGCCGATGAGCTCATTAAAAATGCTGCCTACATTGGCACCCCT
GGAAAGGGTATCCTTGCTGCTGATGAGTCAACAGGCACCATTGGCAAGCG
TCTATCCAGCATCAATGTTGAGAATGTTGAGTCAAACAGGCGTGCTCTCC
GCGAGCTCCTTTTCTGCACTCCCGGTGCCCTTCAGTACCTCAGTGGTGTC
ATCCTCTTCGAGGAGACCCTCTACCAGAAGACTGCTGCTGGCAAGCCCTT
TGTTGATGTCTTGAAGGAGGGTGGAGTCCTCCCTGGAATTAAGGTTGACA
AGGGTACTGTTGAGCTTGCTGGTACCAATGGTGAGACCACCACCCAGGGT
CTTGATGGCCTCGCCCAGCGCTGCCAGAAATACTATGAAGCTGGTGCTCG
TTTTGCCAAATGGCGTGCTGTTCTTAAGATTGGCCCTAATGAGCCTTCGC
AGCTGGCCATCAATGAGAATGCCAATGGCCTGGCCCGATATGCTATCATC
TGCCAGGAGAATGGCCTTGTTCCATTGTTGACCTGAGATCCTTGNTGCGG
CCCATGCATCACAGTGTGCTGTGTACCGAGCGTGTCTGCTGATCTCAGCT
TA
back to top