DC900382

Overview
NameDC900382
Unique NameDC900382
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length905
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900382_ssr1 microsatellite DC900382_ssr1:1..58. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: YY46_ANASP (Uncharacterized WD repeat-containing protein alr3466 OS=Anabaena sp. (strain PCC 7120) GN=alr3466 PE=4 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 1.324e-23
Identity = 62/188 (32.98%), Postives = 99/188 (52.66%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS 647
            +LWD ++   + TL                  +V +VA+SPDG  +A GS D T  ++D++ +K L+ L+GH      +V++P D   L S S D  V + +           GH  WV SV  +PDG+ + +GSSD+TV+LWD++    + +   HT+ V  V+F P G  + S S D+++ L+E S
Sbjct: 1141 RLWDISSKKCLYTLQ-------------GHTNWVNAVAFSPDGATLASGSGDQTVRLWDISSSKCLYILQGHTSWVNSVVFNP-DGSTLASGSSDQTVRLWEINSSKCLCTFQGHTSWVNSVVFNPDGSMLASGSSDKTVRLWDISSSKCLHTFQGHTNWVNSVAFNPDGSMLASGSGDQTVRLWEIS 1314          

HSP 2 Score: 102.834 bits (255), Expect = 2.762e-21
Identity = 60/188 (31.91%), Postives = 94/188 (50.00%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS 647
            +LWD ++ N + TL                  +V  + +SP+G  +A GS D    ++D++  K L+ L+GH      + +SP D   L S S D  V + D         + GH  WV SV  +PDG+ + +GSSD+TV+LW++N    + +   HT  V  V F P G  + S S DK++ L++ S
Sbjct: 1099 RLWDISSGNCLYTLQ-------------GYTSWVRFLVFSPNGVTLANGSSDQIVRLWDISSKKCLYTLQGHTNWVNAVAFSP-DGATLASGSGDQTVRLWDISSSKCLYILQGHTSWVNSVVFNPDGSTLASGSSDQTVRLWEINSSKCLCTFQGHTSWVNSVVFNPDGSMLASGSSDKTVRLWDIS 1272          

HSP 3 Score: 101.293 bits (251), Expect = 8.035e-21
Identity = 53/156 (33.97%), Postives = 85/156 (54.49%), Query Frame = 3
Query:  180 FVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS 647
            +V SV ++PDG  +A GS D T  ++++  +K L   +GH      +V++P D  +L S S D  V + D           GH  WV SV  +PDG+ + +GS D+TV+LW+++    + +   HT  V  V+F P G  + S SDD+++ L+  S
Sbjct: 1202 WVNSVVFNPDGSTLASGSSDQTVRLWEINSSKCLCTFQGHTSWVNSVVFNP-DGSMLASGSSDKTVRLWDISSSKCLHTFQGHTNWVNSVAFNPDGSMLASGSGDQTVRLWEISSSKCLHTFQGHTSWVSSVTFSPDGTMLASGSDDQTVRLWSIS 1356          

HSP 4 Score: 100.908 bits (250), Expect = 1.049e-20
Identity = 53/156 (33.97%), Postives = 83/156 (53.21%), Query Frame = 3
Query:  180 FVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS 647
            +V SV ++PDG  +A GS D T  ++D++ +K LH  +GH      + ++P D  +L S S D  V + +           GH  WV SV  SPDG  + +GS D+TV+LW ++    + +   HT+ V  V F P G  + S S D+++ L+  S
Sbjct: 1244 WVNSVVFNPDGSMLASGSSDKTVRLWDISSSKCLHTFQGHTNWVNSVAFNP-DGSMLASGSGDQTVRLWEISSSKCLHTFQGHTSWVSSVTFSPDGTMLASGSDDQTVRLWSISSGECLYTFLGHTNWVGSVIFSPDGAILASGSGDQTVRLWSIS 1398          

HSP 5 Score: 99.7525 bits (247), Expect = 2.338e-20
Identity = 54/156 (34.62%), Postives = 85/156 (54.49%), Query Frame = 3
Query:  180 FVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS 647
            +V SVA++PDG  +A GS D T  +++++ +K LH  +GH      + +SP D  +L S S D  V +             GH  WV SV  SPDGA + +GS D+TV+LW ++    + ++  H + V  + F P G  + S SDD+++ L+  S
Sbjct: 1286 WVNSVAFNPDGSMLASGSGDQTVRLWEISSSKCLHTFQGHTSWVSSVTFSP-DGTMLASGSDDQTVRLWSISSGECLYTFLGHTNWVGSVIFSPDGAILASGSGDQTVRLWSISSGKCLYTLQGHNNWVGSIVFSPDGTLLASGSDDQTVRLWNIS 1440          

HSP 6 Score: 97.8265 bits (242), Expect = 8.884e-20
Identity = 52/155 (33.55%), Postives = 86/155 (55.48%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS 647
            V SV +S DG  +A GS D T  ++D++    L+ L+GH    R +V+SP D  +L S   D  V + D    +    + G+  WV  +  SP+G  +  GSSD+ V+LWD++ +  + ++  HT+ V  V+F P G  + S S D+++ L++ S
Sbjct: 1035 VRSVVFSSDGAMLASGSDDQTVRLWDISSGNCLYTLQGHTSCVRSVVFSP-DGAMLASGGDDQIVRLWDISSGNCLYTLQGYTSWVRFLVFSPNGVTLANGSSDQIVRLWDISSKKCLYTLQGHTNWVNAVAFSPDGATLASGSGDQTVRLWDIS 1188          

HSP 7 Score: 95.5153 bits (236), Expect = 4.409e-19
Identity = 54/156 (34.62%), Postives = 82/156 (52.56%), Query Frame = 3
Query:  180 FVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS 647
            +V SV +S DG+ +A GS D T  ++D++  + L   +GH    R +V+SP +  +L S S D  V + D           GH  WV SV  + DG+ + TGS D+TV+LWD++          HT  V  V F   G  + S SDD+++ L++ S
Sbjct:  908 WVNSVGFSQDGKMLASGSDDQTVRLWDISSGQCLKTFKGHTSRVRSVVFSP-NSLMLASGSSDQTVRLWDISSGECLYIFQGHTGWVYSVAFNLDGSMLATGSGDQTVRLWDISSSQCFYIFQGHTSCVRSVVFSSDGAMLASGSDDQTVRLWDIS 1062          

HSP 8 Score: 91.2781 bits (225), Expect = 8.315e-18
Identity = 54/155 (34.84%), Postives = 88/155 (56.77%), Query Frame = 3
Query:  180 FVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXD-AEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +V SV +SPDG  +A GS D T  ++ ++  + L+   GH      +++SP D  +L S S D  V +   + GK L T + GH  WV S+  SPDG  + +GS D+TV+LW+++    + ++  H + V  V+F   G  + S SDD++I L++
Sbjct: 1328 WVSSVTFSPDGTMLASGSDDQTVRLWSISSGECLYTFLGHTNWVGSVIFSP-DGAILASGSGDQTVRLWSISSGKCLYT-LQGHNNWVGSIVFSPDGTLLASGSDDQTVRLWNISSGECLYTLHGHINSVRSVAFSSDGLILASGSDDETIKLWD 1480          

HSP 9 Score: 85.5001 bits (210), Expect = 4.563e-16
Identity = 49/155 (31.61%), Postives = 80/155 (51.61%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS 647
            V SV +SP+   +A GS D T  ++D++  + L+  +GH      + ++ +D  +L + S D  V + D           GH   V SV  S DGA + +GS D+TV+LWD++    + ++  HT  V  V F P G  + S  DD+ + L++ S
Sbjct:  951 VRSVVFSPNSLMLASGSSDQTVRLWDISSGECLYIFQGHTGWVYSVAFN-LDGSMLATGSGDQTVRLWDISSSQCFYIFQGHTSCVRSVVFSSDGAMLASGSDDQTVRLWDISSGNCLYTLQGHTSCVRSVVFSPDGAMLASGGDDQIVRLWDIS 1104          

HSP 10 Score: 81.6481 bits (200), Expect = 6.588e-15
Identity = 49/155 (31.61%), Postives = 77/155 (49.68%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS 647
            VL+VA+SPDG+  A G   G    ++    K L   +GH      + +S  D ++L S S D  V + D           GH   V SV  SP+   + +GSSD+TV+LWD++    +     HT  V+ V+F   G  + + S D+++ L++ S
Sbjct:  867 VLTVAFSPDGKLFATGDSGGIVRFWEAATGKELLTCKGHNSWVNSVGFSQ-DGKMLASGSDDQTVRLWDISSGQCLKTFKGHTSRVRSVVFSPNSLMLASGSSDQTVRLWDISSGECLYIFQGHTGWVYSVAFNLDGSMLATGSGDQTVRLWDIS 1020          

HSP 11 Score: 71.633 bits (174), Expect = 6.818e-12
Identity = 42/122 (34.43%), Postives = 65/122 (53.28%), Query Frame = 3
Query:  180 FVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSM 545
            +V SV +SPDG  +A GS D T  ++ ++  K L+ L+GH      +V+SP D  +L S S D  V + +         + GH   V SV  S DG  + +GS D T+KLWD+     ++++
Sbjct: 1370 WVGSVIFSPDGAILASGSGDQTVRLWSISSGKCLYTLQGHNNWVGSIVFSP-DGTLLASGSDDQTVRLWNISSGECLYTLHGHINSVRSVAFSSDGLILASGSDDETIKLWDVKTGECIKTL 1490          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: PKWA_THECU (Probable serine/threonine-protein kinase pkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.607e-21
Identity = 60/154 (38.96%), Postives = 89/154 (57.79%), Query Frame = 3
Query:  180 FVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXD-AEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLY 638
            +V +VA+SPDG  +A GS DGT  ++DV   K    L+        L +SP D  +L   S D+ VH+ D A G++L T   GH  WV +V  SPDGA + +GS DRT++LWD+  +    ++  HT+ V  V+F P G  + S S+D +I ++
Sbjct:  587 YVYAVAFSPDGSMVASGSRDGTIRLWDVATGKERDVLQAPAENVVSLAFSP-DGSMLVHGS-DSTVHLWDVASGEALHT-FEGHTDWVRAVAFSPDGALLASGSDDRTIRLWDVAAQEEHTTLEGHTEPVHSVAFHPEGTTLASASEDGTIRIW 737          

HSP 2 Score: 97.0561 bits (240), Expect = 1.515e-19
Identity = 58/168 (34.52%), Postives = 84/168 (50.00%), Query Frame = 3
Query:  138 PEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            P  L      ++ +  ++VA+SP G  +A GS D    V+DV     LH LEGH    R + +SP D  +L S S D  V + D           GH  +VL +  SPDG+ + +GS D T +LW++        +  HTD V+ V+F P G  V S S D +I L++
Sbjct:  447 PHELNEPRILTTDREAVAVAFSPGGSLLAGGSGDKLIHVWDVASGDELHTLEGHTDWVRAVAFSP-DGALLASGSDDATVRLWDVAAAEERAVFEGHTHYVLDIAFSPDGSMVASGSRDGTARLWNVATGTEHAVLKGHTDYVYAVAFSPDGSMVASGSRDGTIRLWD 613          

HSP 3 Score: 87.8113 bits (216), Expect = 9.193e-17
Identity = 54/154 (35.06%), Postives = 82/154 (53.25%), Query Frame = 3
Query:  180 FVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +VL +A+SPDG  +A GS DGT  +++V        L+GH      + +SP D  ++ S S D  + + D         +   A  V+S+  SPDG+ +  GS D TV LWD+    A+ +   HTD V  V+F P G  + S SDD++I L++
Sbjct:  545 YVLDIAFSPDGSMVASGSRDGTARLWNVATGTEHAVLKGHTDYVYAVAFSP-DGSMVASGSRDGTIRLWDVATGKERDVLQAPAENVVSLAFSPDGSMLVHGS-DSTVHLWDVASGEALHTFEGHTDWVRAVAFSPDGALLASGSDDRTIRLWD 696          

HSP 4 Score: 78.1814 bits (191), Expect = 7.284e-14
Identity = 55/177 (31.07%), Postives = 87/177 (49.15%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSD 617
            +WD A+ + + TL     EG   TD      +V +VA+SPDG  +A GS D T  ++DV  A+     EGH      + +SP D  ++ S S D    + +    +    + GH  +V +V  SPDG+ + +GS D T++LWD+        +    + V  ++F P G  +V  SD
Sbjct:  485 VWDVASGDELHTL-----EG--HTD------WVRAVAFSPDGALLASGSDDATVRLWDVAAAEERAVFEGHTHYVLDIAFSP-DGSMVASGSRDGTARLWNVATGTEHAVLKGHTDYVYAVAFSPDGSMVASGSRDGTIRLWDVATGKERDVLQAPAENVVSLAFSPDGSMLVHGSD 647          

HSP 5 Score: 70.8626 bits (172), Expect = 1.163e-11
Identity = 45/145 (31.03%), Postives = 70/145 (48.28%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDL 518
            +LWD AT             G +     +  + V+S+A+SPDG  +  GS D T  ++DV   + LH  EGH    R + +SP D  +L S S D  + + D   +   T + GH   V SV   P+G  + + S D T+++W +
Sbjct:  610 RLWDVAT-------------GKERDVLQAPAENVVSLAFSPDGSMLVHGS-DSTVHLWDVASGEALHTFEGHTDWVRAVAFSP-DGALLASGSDDRTIRLWDVAAQEEHTTLEGHTEPVHSVAFHPEGTTLASASEDGTIRIWPI 739          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: Y2124_ANASP (Uncharacterized WD repeat-containing protein all2124 OS=Anabaena sp. (strain PCC 7120) GN=all2124 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 5.208e-20
Identity = 59/180 (32.78%), Postives = 91/180 (50.56%), Query Frame = 3
Query:   99 ATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLY 638
            A+ +L  T+ +   +G         +  V SV++SPDG+ IA G  D T  ++  +    L  + GH      + +SP D + L SAS D  + + D     L   ++GH+  V++V  SPDG  I  GS D+TVKLW       ++++  H D V  +SF P G  + S S DK+I L+
Sbjct: 1088 ASGSLDKTIKLWSRDGRLFRTLNGHEDAVYSVSFSPDGQTIASGGSDKTIKLWQTSDGTLLKTITGHEQTVNNVYFSP-DGKNLASASSDHSIKLWDTTSGQLLMTLTGHSAGVITVRFSPDGQTIAAGSEDKTVKLWHRQDGKLLKTLNGHQDWVNSLSFSPDGKTLASASADKTIKLW 1266          

HSP 2 Score: 97.8265 bits (242), Expect = 8.884e-20
Identity = 55/185 (29.73%), Postives = 93/185 (50.27%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLY 638
            KLW T+   L+ T++               ++ V +V +SPDG+ +A  S D +  ++D T  + L  L GH      + +SP D + + + S D  V +   +   L   ++GH  WV S+  SPDG  + + S+D+T+KLW +     ++++  H D VW V+F   G  + S S D +I L+
Sbjct: 1138 KLWQTSDGTLLKTIT-------------GHEQTVNNVYFSPDGKNLASASSDHSIKLWDTTSGQLLMTLTGHSAGVITVRFSP-DGQTIAAGSEDKTVKLWHRQDGKLLKTLNGHQDWVNSLSFSPDGKTLASASADKTIKLWRIADGKLVKTLKGHNDSVWDVNFSSDGKAIASASRDNTIKLW 1308          

HSP 3 Score: 93.5893 bits (231), Expect = 1.675e-18
Identity = 49/153 (32.03%), Postives = 89/153 (58.17%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            V  V +SPDG+ +A  S D T  +++V+  KF   L+GH      + +SP D +++ SAS D  + + D+   +L  ++  H   V SV+ +PDG+ + + S+D+TVKLW  +    + + + H++ V+  SF P G  + S S+DK++ +++
Sbjct: 1449 VNKVNFSPDGKTLASASRDNTVKLWNVSDGKFKKTLKGHTDEVFWVSFSP-DGKIIASASADKTIRLWDSFSGNLIKSLPAHNDLVYSVNFNPDGSMLASTSADKTVKLWRSHDGHLLHTFSGHSNVVYSSSFSPDGRYIASASEDKTVKIWQ 1600          

HSP 4 Score: 92.4337 bits (228), Expect = 3.732e-18
Identity = 62/189 (32.80%), Postives = 91/189 (48.15%), Query Frame = 3
Query:   75 HEXKLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            H  KLWDT +  L+ TL+                  V++V +SPDG+ IA GS D T  ++     K L  L GH      L +SP D + L SAS D  + +       L   + GH   V  V+ S DG AI + S D T+KLW+ +    +++ T H+  V+ V+F P    + S S D +I L++
Sbjct: 1177 HSIKLWDTTSGQLLMTLT-------------GHSAGVITVRFSPDGQTIAAGSEDKTVKLWHRQDGKLLKTLNGHQDWVNSLSFSP-DGKTLASASADKTIKLWRIADGKLVKTLKGHNDSVWDVNFSSDGKAIASASRDNTIKLWNRH-GIELETFTGHSGGVYAVNFLPDSNIIASASLDNTIRLWQ 1350          

HSP 5 Score: 88.5817 bits (218), Expect = 5.390e-17
Identity = 55/185 (29.73%), Postives = 87/185 (47.03%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLY 638
            +LW +   +L+ TL                 K +  ++++P G  IA  + D T  ++ V   K L  L GH      + +SP D + L SAS D  V + +         + GH   V  V  SPDG  I + S+D+T++LWD      ++S+  H D V+ V+F P G  + S S DK++ L+
Sbjct: 1388 QLWHSQDGSLLKTLP--------------GNKAIYGISFTPQGDLIASANADKTVKIWRVRDGKALKTLIGHDNEVNKVNFSP-DGKTLASASRDNTVKLWNVSDGKFKKTLKGHTDEVFWVSFSPDGKIIASASADKTIRLWDSFSGNLIKSLPAHNDLVYSVNFNPDGSMLASTSADKTVKLW 1557          

HSP 6 Score: 78.9518 bits (193), Expect = 4.270e-14
Identity = 47/155 (30.32%), Postives = 79/155 (50.97%), Query Frame = 3
Query:  174 KKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLY 638
            K  V+S++ S DG+ IA GS+D T  ++     +    L GH      + +SP D + + S   D  + +      +L   ++GH   V +V  SPDG  + + SSD ++KLWD      + ++T H+  V  V F P G  + + S+DK++ L+
Sbjct: 1072 KDGVISISISRDGQTIASGSLDKTIKLWS-RDGRLFRTLNGHEDAVYSVSFSP-DGQTIASGGSDKTIKLWQTSDGTLLKTITGHEQTVNNVYFSPDGKNLASASSDHSIKLWDTTSGQLLMTLTGHSAGVITVRFSPDGQTIAAGSEDKTVKLW 1224          

HSP 7 Score: 75.0998 bits (183), Expect = 6.167e-13
Identity = 55/182 (30.22%), Postives = 93/182 (51.10%), Query Frame = 3
Query:   99 ATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDA-EGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            A+ +L  T+ + +   + P +  +    V +V++  DG  IA    DG   ++       L  L G+      + ++P    ++ SA+ D  V I    +GK+L T + GH   V  V+ SPDG  + + S D TVKLW+++     +++  HTD+V+ VSF P G  + S S DK+I L++
Sbjct: 1338 ASASLDNTIRLWQRPLISPLEVLAGNSGVYAVSFLHDGSIIATAGADGNIQLWHSQDGSLLKTLPGN-KAIYGISFTPQGD-LIASANADKTVKIWRVRDGKALKTLI-GHDNEVNKVNFSPDGKTLASASRDNTVKLWNVSDGKFKKTLKGHTDEVFWVSFSPDGKIIASASADKTIRLWD 1516          

HSP 8 Score: 69.3218 bits (168), Expect = 3.384e-11
Identity = 50/156 (32.05%), Postives = 70/156 (44.87%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTN 551
            +LWD+ + NLI +L              +    V SV ++PDG  +A  S D T  ++       LH   GH        +SP D R + SAS D  V I   +G  L T +  H   V+S   SPDG  + +GS D T K+W  + + A  S  N
Sbjct: 1513 RLWDSFSGNLIKSLP-------------AHNDLVYSVNFNPDGSMLASTSADKTVKLWRSHDGHLLHTFSGHSNVVYSSSFSP-DGRYIASASEDKTVKIWQIDGH-LLTTLPQHQAGVMSAIFSPDGKTLISGSLDTTTKIWRFDSQQAKTSQMN 1653          

HSP 9 Score: 68.1662 bits (165), Expect = 7.538e-11
Identity = 36/102 (35.29%), Postives = 55/102 (53.92%), Query Frame = 3
Query:  336 DPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            D + + S S D  + +   +G+   T ++GH   V SV  SPDG  I +G SD+T+KLW  +    ++++T H   V  V F P G  + S S D SI L++
Sbjct: 1083 DGQTIASGSLDKTIKLWSRDGRLFRT-LNGHEDAVYSVSFSPDGQTIASGGSDKTIKLWQTSDGTLLKTITGHEQTVNNVYFSPDGKNLASASSDHSIKLWD 1183          

HSP 10 Score: 68.1662 bits (165), Expect = 7.538e-11
Identity = 49/157 (31.21%), Postives = 73/157 (46.50%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSP---VDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEY 644
            V  V++SPDG+ IA  S D T  ++D      +  L  H      LVYS     D  +L S S D  V +  +    L    SGH+  V S   SPDG  I + S D+TVK+W ++    + ++  H   V    F P G  ++S S D +  ++ +
Sbjct: 1491 VFWVSFSPDGKIIASASADKTIRLWDSFSGNLIKSLPAH----NDLVYSVNFNPDGSMLASTSADKTVKLWRSHDGHLLHTFSGHSNVVYSSSFSPDGRYIASASEDKTVKIWQIDGH-LLTTLPQHQAGVMSAIFSPDGKTLISGSLDTTTKIWRF 1642          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR61_DICDI (WD repeat-containing protein 61 homolog OS=Dictyostelium discoideum GN=wdr61 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.160e-19
Identity = 54/159 (33.96%), Postives = 91/159 (57.23%), Query Frame = 3
Query:  168 SSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTA-MSGHAXWVLSVDASPDGAAI-TTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLY 638
            ++ K VL++A SP+  +IA   +DGT   +DV   + +  ++ H +P R L +S  D + +F+ + D+ + + D    +   A + GH+ ++ S+ AS +G  + ++GS DR V +WD+  R    S T H DQ W ++F P   ++VSVSDD SI  Y
Sbjct:  138 NTNKQVLTMAISPNNEQIAVAGLDGTVLCYDVESGRRVSEIKAHGVPIRSLCFSS-DSKTIFTGAEDSQIRLHDPNSSNPYIASLLGHSSFIFSLVASSNGDLLASSGSIDRKVCIWDIKTRKLDSSFTAHADQTWDLAFSPDSTKLVSVSDDCSIHSY 295          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: Y2800_ANASP (Uncharacterized WD repeat-containing protein alr2800 OS=Anabaena sp. (strain PCC 7120) GN=alr2800 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.515e-19
Identity = 52/154 (33.77%), Postives = 88/154 (57.14%), Query Frame = 3
Query:  180 FVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            + L VA+SPD + +A GS D T  ++D    K++  LEGH      + +SP D + L SAS D+ V + +         +  H  WV +V   P G  I TGS+D TVKLW+++    +++++ H+D++ G+++ P G  + S S D+S+ L++
Sbjct:  938 WALPVAFSPDRQILASGSNDKTVKLWDWQTGKYISSLEGHTDFIYGIAFSP-DSQTLASASTDSSVRLWNISTGQCFQILLEHTDWVYAVVFHPQGKIIATGSADCTVKLWNISTGQCLKTLSEHSDKILGMAWSPDGQLLASASADQSVRLWD 1090          

HSP 2 Score: 96.6709 bits (239), Expect = 1.979e-19
Identity = 60/186 (32.26%), Postives = 96/186 (51.61%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXD-AEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLY 638
            KLW+ +T   + TLS       + +DK      +L +AWSPDG+ +A  S D +  ++D    + +  L GH       ++SP +  ++ + S D  V I D  +GK L T ++GH  WV  +  SPDG  + + S D+TV++WD+N          HT  V  V+F P G  V S S D+++ ++
Sbjct: 1045 KLWNISTGQCLKTLS-------EHSDK------ILGMAWSPDGQLLASASADQSVRLWDCCTGRCVGILRGHSNRVYSAIFSP-NGEIIATCSTDQTVKIWDWQQGKCLKT-LTGHTNWVFDIAFSPDGKILASASHDQTVRIWDVNTGKCHHICIGHTHLVSSVAFSPDGEVVASGSQDQTVRIW 1215          

HSP 3 Score: 94.7449 bits (234), Expect = 7.521e-19
Identity = 62/194 (31.96%), Postives = 95/194 (48.97%), Query Frame = 3
Query:   63 CRIRHEXKLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXD-AEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            C      KLW       I TL+    E             V SVA+ PDG  +A  S D T  ++D+     L  L GH    R + +SP D   L S++ D  + + D ++GK L T  S H  WV SV  S DG  + +GS DRT+K+W+ +    +++   HT+ V+ +++ P    +VS S D++I L++
Sbjct:  702 CGADENVKLWSVRDGVCIKTLTGHEHE-------------VFSVAFHPDGETLASASGDKTIKLWDIQDGTCLQTLTGHTDWVRCVAFSP-DGNTLASSAADHTIKLWDVSQGKCLRTLKS-HTGWVRSVAFSADGQTLASGSGDRTIKIWNYHTGECLKTYIGHTNSVYSIAYSPDSKILVSGSGDRTIKLWD 880          

HSP 4 Score: 93.5893 bits (231), Expect = 1.675e-18
Identity = 53/155 (34.19%), Postives = 81/155 (52.26%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS 647
            +LS A+SP+G+ +A    D    V++V   K L    GH    R +V+SP D  +L S   D +V +           ++GH   V SV   PDG  + + S D+T+KLWD+     +Q++T HTD V  V+F P G  + S + D +I L++ S
Sbjct:  645 ILSAAFSPEGQLLATCDTDCHVRVWEVKSGKLLLICRGHSNWVRFVVFSP-DGEILASCGADENVKLWSVRDGVCIKTLTGHEHEVFSVAFHPDGETLASASGDKTIKLWDIQDGTCLQTLTGHTDWVRCVAFSPDGNTLASSAADHTIKLWDVS 798          

HSP 5 Score: 93.2041 bits (230), Expect = 2.188e-18
Identity = 58/185 (31.35%), Postives = 89/185 (48.11%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLY 638
            KLWD      + TL+                 +V  VA+SPDG  +A  + D T  ++DV++ K L  L+ H    R + +S  D + L S S D  + I +           GH   V S+  SPD   + +GS DRT+KLWD      ++++  HT++V  V+F P G  +  VS D+S+ L+
Sbjct:  751 KLWDIQDGTCLQTLT-------------GHTDWVRCVAFSPDGNTLASSAADHTIKLWDVSQGKCLRTLKSHTGWVRSVAFS-ADGQTLASGSGDRTIKIWNYHTGECLKTYIGHTNSVYSIAYSPDSKILVSGSGDRTIKLWDCQTHICIKTLHGHTNEVCSVAFSPDGQTLACVSLDQSVRLW 921          

HSP 6 Score: 90.5077 bits (223), Expect = 1.418e-17
Identity = 51/155 (32.90%), Postives = 77/155 (49.68%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS 647
            V S+A+SPD + +  GS D T  ++D      +  L GH      + +SP D + L   S D  V + +        A  G+  W L V  SPD   + +GS+D+TVKLWD      + S+  HTD ++G++F P    + S S D S+ L+  S
Sbjct:  855 VYSIAYSPDSKILVSGSGDRTIKLWDCQTHICIKTLHGHTNEVCSVAFSP-DGQTLACVSLDQSVRLWNCRTGQCLKAWYGNTDWALPVAFSPDRQILASGSNDKTVKLWDWQTGKYISSLEGHTDFIYGIAFSPDSQTLASASTDSSVRLWNIS 1008          

HSP 7 Score: 87.4261 bits (215), Expect = 1.201e-16
Identity = 56/186 (30.11%), Postives = 96/186 (51.61%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +LW+ +T      L       L+ TD      +V +V + P G+ IA GS D T  +++++  + L  L  H      + +SP D ++L SAS D  V + D         + GH+  V S   SP+G  I T S+D+TVK+WD      ++++T HT+ V+ ++F P G  + S S D+++ +++
Sbjct: 1003 RLWNISTGQCFQIL-------LEHTD------WVYAVVFHPQGKIIATGSADCTVKLWNISTGQCLKTLSEHSDKILGMAWSP-DGQLLASASADQSVRLWDCCTGRCVGILRGHSNRVYSAIFSPNGEIIATCSTDQTVKIWDWQQGKCLKTLTGHTNWVFDIAFSPDGKILASASHDQTVRIWD 1174          

HSP 8 Score: 87.0409 bits (214), Expect = 1.568e-16
Identity = 55/188 (29.26%), Postives = 92/188 (48.94%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS 647
            KLWD  T   I TL     E             V SVA+SPDG+ +AC S+D +  +++    + L    G+      + +SP D ++L S S D  V + D +     +++ GH  ++  +  SPD   + + S+D +V+LW+++     Q +  HTD V+ V F P G  + + S D ++ L+  S
Sbjct:  877 KLWDCQTHICIKTLHGHTNE-------------VCSVAFSPDGQTLACVSLDQSVRLWNCRTGQCLKAWYGNTDWALPVAFSP-DRQILASGSNDKTVKLWDWQTGKYISSLEGHTDFIYGIAFSPDSQTLASASTDSSVRLWNISTGQCFQILLEHTDWVYAVVFHPQGKIIATGSADCTVKLWNIS 1050          

HSP 9 Score: 83.5741 bits (205), Expect = 1.734e-15
Identity = 46/155 (29.68%), Postives = 78/155 (50.32%), Query Frame = 3
Query:  180 FVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEY 644
            +V  V +SPDG  +A    D    ++ V     +  L GH      + + P D   L SAS D  + + D +  +    ++GH  WV  V  SPDG  + + ++D T+KLWD++    ++++ +HT  V  V+F   G  + S S D++I ++ Y
Sbjct:  686 WVRFVVFSPDGEILASCGADENVKLWSVRDGVCIKTLTGHEHEVFSVAFHP-DGETLASASGDKTIKLWDIQDGTCLQTLTGHTDWVRCVAFSPDGNTLASSAADHTIKLWDVSQGKCLRTLKSHTGWVRSVAFSADGQTLASGSGDRTIKIWNY 839          

HSP 10 Score: 73.1738 bits (178), Expect = 2.343e-12
Identity = 46/187 (24.60%), Postives = 93/187 (49.73%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEY 644
            KLWD  T   I++L     EG   TD      F+  +A+SPD + +A  S D +  +++++  +    L  H      +V+ P   +++ + S D  V + +         +S H+  +L +  SPDG  + + S+D++V+LWD      +  +  H+++V+   F P G  + + S D+++ ++++
Sbjct:  961 KLWDWQTGKYISSL-----EG--HTD------FIYGIAFSPDSQTLASASTDSSVRLWNISTGQCFQILLEHTDWVYAVVFHP-QGKIIATGSADCTVKLWNISTGQCLKTLSEHSDKILGMAWSPDGQLLASASADQSVRLWDCCTGRCVGILRGHSNRVYSAIFSPNGEIIATCSTDQTVKIWDW 1133          

HSP 11 Score: 71.2478 bits (173), Expect = 8.904e-12
Identity = 48/152 (31.58%), Postives = 67/152 (44.08%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQ 539
            +LWD  T   +  L                   V S  +SP+G  IA  S D T  ++D  + K L  L GH      + +SP D ++L SAS D  V I D           GH   V SV  SPDG  + +GS D+TV++W++     +Q
Sbjct: 1087 RLWDCCTGRCVGILR-------------GHSNRVYSAIFSPNGEIIATCSTDQTVKIWDWQQGKCLKTLTGHTNWVFDIAFSP-DGKILASASHDQTVRIWDVNTGKCHHICIGHTHLVSSVAFSPDGEVVASGSQDQTVRIWNVKTGECLQ 1224          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR5_DICDI (WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.418e-17
Identity = 51/155 (32.90%), Postives = 80/155 (51.61%), Query Frame = 3
Query:  177 KFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            K + SV +SPDG+ +A  S D T  ++     KF   LEGH      + +S  D +++ SAS D  + I D E   +   + GH  +V  V  +P    I +GS D  V++WD+N     + ++ H+D V GV F   G  VVS S D ++ +++
Sbjct:   47 KSISSVKFSPDGKWLASASADKTIKIWGAYDGKFERTLEGHKEGISDIAWSQ-DSKLICSASDDKTIKIWDVESGKMVKTLKGHKEYVFGVSFNPQSNLIVSGSFDENVRIWDVNTGECTKMISAHSDPVTGVHFNRDGTLVVSGSYDGTVRIWD 200          

HSP 2 Score: 71.633 bits (174), Expect = 6.818e-12
Identity = 45/159 (28.30%), Postives = 77/159 (48.43%), Query Frame = 3
Query:  174 KKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSM-TNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS 647
            K+ +  +AWS D + I   S D T  ++DV   K +  L+GH      + ++P    ++ S S D +V I D         +S H+  V  V  + DG  + +GS D TV++WD      + ++ T    +V  V F P G  V++ + D ++ L+ Y+
Sbjct:   88 KEGISDIAWSQDSKLICSASDDKTIKIWDVESGKMVKTLKGHKEYVFGVSFNP-QSNLIVSGSFDENVRIWDVNTGECTKMISAHSDPVTGVHFNRDGTLVVSGSYDGTVRIWDTTTGQLLNTISTEDGKEVSFVKFSPNGKFVLAGTLDNTLRLWSYN 245          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: TUP1_DICDI (General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.418e-17
Identity = 59/160 (36.88%), Postives = 79/160 (49.38%), Query Frame = 3
Query:  180 FVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAE-GKSLXTAMS---GHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS 647
            ++ SV +SPDG  +A G+ D T  V+D+   K  H   GH +    L YS  D R + S S D    I D E GK   T  +   G    V SV  SPDG  +  GS D  V+LWD      ++    H D V+ V+F P G  + S S DKS+ L++ S
Sbjct:  329 YIRSVCFSPDGNYLATGAEDKTVKVWDIHTKKIQHTFYGHELDIYSLDYSS-DGRFIVSGSGDKKAKIWDIEKGKCAFTLGNEEVGPKNGVTSVAMSPDGRLVAAGSLDNIVRLWDAQTGYFLERYEGHLDSVYSVAFSPDGKSLASGSLDKSLKLWDLS 487          

HSP 2 Score: 85.5001 bits (210), Expect = 4.563e-16
Identity = 55/172 (31.98%), Postives = 78/172 (45.35%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXT----AMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRP 587
            K+WD        TL           ++   K  V SVA SPDGR +A GS+D    ++D     FL   EGH      + +SP D + L S S D  + + D  G    +      +GH  +VLSV  SPDG+ + +GS DR+V+ WD         +  H + V  V+  P
Sbjct:  394 KIWDIEKGKCAFTLG---------NEEVGPKNGVTSVAMSPDGRLVAAGSLDNIVRLWDAQTGYFLERYEGHLDSVYSVAFSP-DGKSLASGSLDKSLKLWDLSGSRSRSRCRATFNGHKDFVLSVAFSPDGSWLISGSKDRSVQFWDPRNGTTHMMLQGHKNSVISVALSP 555          

HSP 3 Score: 75.8702 bits (185), Expect = 3.615e-13
Identity = 51/160 (31.87%), Postives = 82/160 (51.25%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPV---DPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLN---MRAAMQSMTN-HTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            + S+ +S DGR I  GS D    ++D+ + K    L    +  +  V S     D R++ + S D  V + DA+         GH   V SV  SPDG ++ +GS D+++KLWDL+    R+  ++  N H D V  V+F P G  ++S S D+S+  ++
Sbjct:  372 IYSLDYSSDGRFIVSGSGDKKAKIWDIEKGKCAFTLGNEEVGPKNGVTSVAMSPDGRLVAAGSLDNIVRLWDAQTGYFLERYEGHLDSVYSVAFSPDGKSLASGSLDKSLKLWDLSGSRSRSRCRATFNGHKDFVLSVAFSPDGSWLISGSKDRSVQFWD 531          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: KTNB1_STRPU (Katanin p80 WD40-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.852e-17
Identity = 50/151 (33.11%), Postives = 72/151 (47.68%), Query Frame = 3
Query:  189 SVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            SV ++     +  GS  GT  ++D+  AK +  L GH    R + + P    V  S S DT+V + D   K       GH+  V  +  SPDG  + T S D T+KLWDL M    Q   NHT  V G+ F P    + S S D+++  ++
Sbjct:   64 SVKFNSSEELVVAGSQSGTMKIYDLEPAKIVRTLTGHRNSIRCMDFHPFGEFVA-SGSTDTNVKLWDVRRKGCIYTYKGHSDQVNMIKFSPDGKWLVTASEDTTIKLWDLTMGKLFQEFKNHTGGVTGIEFHPNEFLLASGSSDRTVQFWD 213          

HSP 2 Score: 68.9366 bits (167), Expect = 4.419e-11
Identity = 42/139 (30.22%), Postives = 64/139 (46.04%), Query Frame = 3
Query:  204 PDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDD 620
            P G  +A GS D    ++DV R   ++  +GH      + +SP D + L +AS DT + + D     L      H   V  ++  P+   + +GSSDRTV+ WDL     + S +     V  +SF P G  +   S D
Sbjct:  111 PFGEFVASGSTDTNVKLWDVRRKGCIYTYKGHSDQVNMIKFSP-DGKWLVTASEDTTIKLWDLTMGKLFQEFKNHTGGVTGIEFHPNEFLLASGSSDRTVQFWDLETFQLVSSTSPGASAVRSISFHPDGSYLFCSSQD 248          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WD51B_MOUSE (WD repeat-containing protein 51B OS=Mus musculus GN=Wdr51b PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.959e-16
Identity = 59/185 (31.89%), Postives = 89/185 (48.11%), Query Frame = 3
Query:  108 NLIATLSIXRPEGLKPTD-KXSSKKF------VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            NL+A+ S  R   L   D K  S +F      V SV +S DG+ +   S D +  V+ + R +FL+ L  H    R   +SP D R++ S S D  + I D   K      S    +   VD +P+G  I +  SD  VK+WD+ M   +Q    H+  V  +SF PLG  +V+ S D ++ + +
Sbjct:   73 NLLASASRDRTVRLWVLDRKGKSSEFKAHTAPVRSVDFSADGQLLVTASEDKSIKVWSMFRQRFLYSLYRHTHWVRCAKFSP-DGRLIVSCSEDKTIKIWDTTNKQCVNNFSDSVGFANFVDFNPNGTCIASAGSDHAVKIWDIRMNKLLQHYQVHSCGVNCLSFHPLGNSLVTASSDGTVKMLD 256          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WD51A_HUMAN (WD repeat-containing protein 51A OS=Homo sapiens GN=WDR51A PE=2 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 3.862e-15
Identity = 49/153 (32.03%), Postives = 71/153 (46.41%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            V SV +  DG+     S D T  V+   R KFL  L  H    R   +SP D R++ SAS D  V + D   +    +   H  +V  VD  P G  I     D TVK+WD+     +Q    H+  V G+SF P G  +++ S D ++ + +
Sbjct:  106 VRSVHFCSDGQSFVTASDDKTVKVWATHRQKFLFSLSQHINWVRCAKFSP-DGRLIVSASDDKTVKLWDKSSRECVHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDVRTHRLLQHYQLHSAAVNGLSFHPSGNYLITASSDSTLKILD 257          

HSP 2 Score: 71.633 bits (174), Expect = 6.818e-12
Identity = 48/155 (30.97%), Postives = 73/155 (47.10%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS 647
            V  V +S + +++A GSMD    V+ +      +   GH      + +SP    +L S S D  V I     K   T    H   V SV    DG +  T S D+TVK+W  + +  + S++ H + V    F P G  +VS SDDK++ L++ S
Sbjct:   22 VTCVDFSINTKQLASGSMDSCLMVWHMKPQSRAYRFTGHKDAVTCVNFSP-SGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSFVTASDDKTVKVWATHRQKFLFSLSQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKS 175          
The following BLAST results are available for this feature:
BLAST of DC900382 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 138
Match NameE-valueIdentityDescription
YY46_ANASP1.324e-2332.98Uncharacterized WD repeat-containing protein alr34... [more]
PKWA_THECU3.607e-2138.96Probable serine/threonine-protein kinase pkwA OS=T... [more]
Y2124_ANASP5.208e-2032.78Uncharacterized WD repeat-containing protein all21... [more]
WDR61_DICDI1.160e-1933.96WD repeat-containing protein 61 homolog OS=Dictyos... [more]
Y2800_ANASP1.515e-1933.77Uncharacterized WD repeat-containing protein alr28... [more]
WDR5_DICDI1.418e-1732.90WD repeat-containing protein 5 homolog OS=Dictyost... [more]
TUP1_DICDI1.418e-1736.88General transcriptional corepressor tupA OS=Dictyo... [more]
KTNB1_STRPU1.852e-1733.11Katanin p80 WD40-containing subunit B1 OS=Strongyl... [more]
WD51B_MOUSE5.959e-1631.89WD repeat-containing protein 51B OS=Mus musculus G... [more]
WD51A_HUMAN3.862e-1532.03WD repeat-containing protein 51A OS=Homo sapiens G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900382 VSS Citrus sinensis cDNA clone VS28955 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900382 ID=DC900382|Name=DC900382|organism=Citrus sinensis|type=EST|length=905bp
TCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTC
TCTCTCTCCTCGTGCCGAATTCGGCACGAGGNAAAGCTCTGGGACACAGC
CACTTGGAATCTGATTGCCACCCTGTCAATTNCTCGNCCAGAAGGACTGA
AGCCGACAGATAAAAGNAGCAGCAAGAAGTTTGTTCTATCAGTTGCATGG
AGTCCTGATGGCAGACGAATTGCTTGTGGNTCAATGGATGGCACAATNTC
TGTTTTTGATGTTACCCGCGCCAAATTCCTGCATNATCTGGAAGGCCATT
TCATGCCTGNGCGTNCTCTTGTTTATTCCCCTGTTGATCCACGTGTNCTC
TTCTCTGCATCANATGATACTCATGTGCACATTNATGATGCTGAGGGTAA
AAGTCTGGNTACGGCAATGTCTGGTCATGCTAGNTGGGTGTTGAGTGTTG
ATGCAAGCCCCGATGGAGCAGCTATTACAACAGGCTCAAGTGATAGAACT
GTAAAGCTCTGGGATCTTAACATGAGAGCAGCCATGCAGTCAATGACTAA
CCACACAGACCAGGTCTGGGGAGTGTCATTTAGACCACTAGGAGGTCGGG
TTGTTAGCGTATCAGATGACAAAAGCATATCACTCTATGAATACTCCTGA
TGATAAGGCATTTTCAAAGTAAGACTATTGCAAAGTTTTTGTTTGTTATT
TGAAAATGCTAATGCTATTGTTGTTCTTAACTGCATTGGTCTGAAATTGT
ATGCCNTTCCAACCTANATTAGTCTTCNGCNTANCNTGNTTTTTTGANCA
TTTTCATCATCTNAAAAAANCCGACATTTGGNGGACTGATGTCTAGTAGT
TGNGCNCAAGTAGTTGGCATGGTGGTAAAGTGNCTTCCCCCTTTGCTTTG
GATGC
back to top