DC900382

Overview
NameDC900382
Unique NameDC900382
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length905
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900382_ssr1 microsatellite DC900382_ssr1:1..58. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: LIS1_MOUSE (Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 7.538e-11
Identity = 37/120 (30.83%), Postives = 58/120 (48.33%), Query Frame = 3
Query:  282 HXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            + L GH  P   +++ PV   V+ SAS D  + + D E       + GH   V  +     G  + + S+D T+KLWD      +++M  H   V  V+  P G  +VS S DK+I ++E
Sbjct:  102 YALSGHRSPVTRVIFHPVFS-VMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWE 220          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: LIS1_HUMAN (Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 7.538e-11
Identity = 37/120 (30.83%), Postives = 58/120 (48.33%), Query Frame = 3
Query:  282 HXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            + L GH  P   +++ PV   V+ SAS D  + + D E       + GH   V  +     G  + + S+D T+KLWD      +++M  H   V  V+  P G  +VS S DK+I ++E
Sbjct:  102 YALSGHRSPVTRVIFHPVFS-VMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWE 220          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: CIAO1_CHLRE (Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 7.538e-11
Identity = 50/165 (30.30%), Postives = 83/165 (50.30%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKF--LHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDA-EGKSL--XTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLW--DLNMRAAMQSM----TNHTDQVWGVSFRPLG-GRVVSVSDDKSISLYE 641
            + SVAWSP GR +A  S D T +V++++   +  +  LEGH    + + ++P D R++ +   D  V I ++  G+         GH+  V +V   P G  + +   D T+KLW  D +     Q++    T H   VW V + P+   R+ S SDD ++ L+E
Sbjct:   68 IRSVAWSPTGRALATASFDATVAVWELSSGVWEQVAELEGHENEVKCVAWNP-DGRLIATCGRDRSVWIWESMPGREFECVDVKQGHSQDVKAVTWHPSGELLVSAGYDDTIKLWTYDGDEWGCAQTLGGTGTGHESTVWDVCWDPVSRARLASCSDDLTLRLWE 231          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR5B_RAT (WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 9.845e-11
Identity = 40/146 (27.40%), Postives = 69/146 (47.26%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDD 620
            + SV +SP+G  +A  + D    ++     K    L GH +    + +S    R L SAS D  + + D         + GH+ +V   D +P    I +GS D +VK+W++     +++++ H+D +  V F   G  +VS S D
Sbjct:   42 ISSVKFSPNGEWLASSAADALIIIWGAYDGKCKKTLYGHSLEISDVAWSSDSSR-LVSASDDKTLKLWDVRSGKCLKTLKGHSDFVFCCDFNPPSNLIVSGSFDESVKIWEVKTGKCLKTLSAHSDPISAVHFHCNGSLIVSGSYD 186          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: TAF5L_HUMAN (TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 9.845e-11
Identity = 41/147 (27.89%), Postives = 67/147 (45.58%), Query Frame = 3
Query:  201 SPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            SP     A GS D T  ++   R   L    GH      + + P +   L + S D  V +  A+  +     +GH   VLS+  SP+G  + +   D+ +KLWDL      + +  HTD +  ++F P  G + S S D S+ +++
Sbjct:  393 SPYSLYFASGSHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHP-NSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLAFSPNGKYLASAGEDQRLKLWDLASGTLYKELRGHTDNITSLTFSPDSGLIASASMDNSVRVWD 538          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: LIS1_CHICK (Platelet-activating factor acetylhydrolase IB subunit alpha OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3)

HSP 1 Score: 67.781 bits (164), Expect = 9.845e-11
Identity = 37/120 (30.83%), Postives = 58/120 (48.33%), Query Frame = 3
Query:  282 HXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            + L GH  P   +++ PV   V+ SAS D  + + D E       + GH   V  +     G  + + S+D T+KLWD      +++M  H   V  V+  P G  +VS S DK+I ++E
Sbjct:  102 YALSGHRSPVTRVIFHPVFS-VMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHTGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWE 220          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: LIS1_BOVIN (Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 9.845e-11
Identity = 37/120 (30.83%), Postives = 58/120 (48.33%), Query Frame = 3
Query:  282 HXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            + L GH  P   +++ PV   V+ SAS D  + + D E       + GH   V  +     G  + + S+D T+KLWD      +++M  H   V  V+  P G  +VS S DK+I ++E
Sbjct:  102 YALSGHRSPVTRVIFHPVFS-VMVSASEDATIKVWDYETGDFERTLKGHTDSVEDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWE 220          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: LIS1A_DANRE (Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3)

HSP 1 Score: 67.781 bits (164), Expect = 9.845e-11
Identity = 37/120 (30.83%), Postives = 58/120 (48.33%), Query Frame = 3
Query:  282 HXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            + L GH  P   +++ PV   V+ SAS D  + + D E       + GH   V  +     G  + + S+D T+KLWD      +++M  H   V  V+  P G  +VS S DK+I ++E
Sbjct:  102 YALSGHRSPVTRVIFHPVFS-VIVSASEDATIKVWDHETGDFERTLKGHTDSVQDISFDHTGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWE 220          
The following BLAST results are available for this feature:
BLAST of DC900382 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 138
Match NameE-valueIdentityDescription
LIS1_MOUSE7.538e-1130.83Platelet-activating factor acetylhydrolase IB subu... [more]
LIS1_HUMAN7.538e-1130.83Platelet-activating factor acetylhydrolase IB subu... [more]
CIAO1_CHLRE7.538e-1130.30Probable cytosolic iron-sulfur protein assembly pr... [more]
WDR5B_RAT9.845e-1127.40WD repeat-containing protein 5B OS=Rattus norvegic... [more]
TAF5L_HUMAN9.845e-1127.89TAF5-like RNA polymerase II p300/CBP-associated fa... [more]
LIS1_CHICK9.845e-1130.83Platelet-activating factor acetylhydrolase IB subu... [more]
LIS1_BOVIN9.845e-1130.83Platelet-activating factor acetylhydrolase IB subu... [more]
LIS1A_DANRE9.845e-1130.83Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900382 VSS Citrus sinensis cDNA clone VS28955 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900382 ID=DC900382|Name=DC900382|organism=Citrus sinensis|type=EST|length=905bp
TCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTC
TCTCTCTCCTCGTGCCGAATTCGGCACGAGGNAAAGCTCTGGGACACAGC
CACTTGGAATCTGATTGCCACCCTGTCAATTNCTCGNCCAGAAGGACTGA
AGCCGACAGATAAAAGNAGCAGCAAGAAGTTTGTTCTATCAGTTGCATGG
AGTCCTGATGGCAGACGAATTGCTTGTGGNTCAATGGATGGCACAATNTC
TGTTTTTGATGTTACCCGCGCCAAATTCCTGCATNATCTGGAAGGCCATT
TCATGCCTGNGCGTNCTCTTGTTTATTCCCCTGTTGATCCACGTGTNCTC
TTCTCTGCATCANATGATACTCATGTGCACATTNATGATGCTGAGGGTAA
AAGTCTGGNTACGGCAATGTCTGGTCATGCTAGNTGGGTGTTGAGTGTTG
ATGCAAGCCCCGATGGAGCAGCTATTACAACAGGCTCAAGTGATAGAACT
GTAAAGCTCTGGGATCTTAACATGAGAGCAGCCATGCAGTCAATGACTAA
CCACACAGACCAGGTCTGGGGAGTGTCATTTAGACCACTAGGAGGTCGGG
TTGTTAGCGTATCAGATGACAAAAGCATATCACTCTATGAATACTCCTGA
TGATAAGGCATTTTCAAAGTAAGACTATTGCAAAGTTTTTGTTTGTTATT
TGAAAATGCTAATGCTATTGTTGTTCTTAACTGCATTGGTCTGAAATTGT
ATGCCNTTCCAACCTANATTAGTCTTCNGCNTANCNTGNTTTTTTGANCA
TTTTCATCATCTNAAAAAANCCGACATTTGGNGGACTGATGTCTAGTAGT
TGNGCNCAAGTAGTTGGCATGGTGGTAAAGTGNCTTCCCCCTTTGCTTTG
GATGC
back to top