DC900382

Overview
NameDC900382
Unique NameDC900382
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length905
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900382_ssr1 microsatellite DC900382_ssr1:1..58. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WD51B_HUMAN (WD repeat-containing protein 51B OS=Homo sapiens GN=WDR51B PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 5.045e-15
Identity = 57/185 (30.81%), Postives = 89/185 (48.11%), Query Frame = 3
Query:  108 NLIATLSIXRPEGLKPTDKXSS-KKF------VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            NL+A+ S  R   L   DK     +F      V SV +S DG+ +A  S D +  V+ + R +FL+ L  H    R   +SP D R++ S S D  + I D   K      S    +   VD +P G  I +  SD+TVK+WD+ +   +Q    H+  V  +SF P G  +++ S D ++ + +
Sbjct:   73 NLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFLATASEDKSIKVWSMYRQRFLYSLYRHTHWVRCAKFSP-DGRLIVSCSEDKTIKIWDTTNKQCVNNFSDSVGFANFVDFNPSGTCIASAGSDQTVKVWDVRVNKLLQHYQVHSGGVNCISFHPSGNYLITASSDGTLKILD 256          

HSP 2 Score: 69.707 bits (169), Expect = 2.591e-11
Identity = 44/156 (28.21%), Postives = 76/156 (48.72%), Query Frame = 3
Query:  174 KKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            K  + S+  SP+G+++A  S D    +++       +   GH      + +SP    +L SAS D  V +   + +   +    H   V SVD S DG  + T S D+++K+W +  +  + S+  HT  V    F P G  +VS S+DK+I +++
Sbjct:   18 KAAITSLDLSPNGKQLATASWDTFLMLWNFKPHARAYRYVGHKDVVTSVQFSP-HGNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFLATASEDKSIKVWSMYRQRFLYSLYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIWD 172          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WD51A_BOVIN (WD repeat-containing protein 51A OS=Bos taurus GN=WDR51A PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.124e-14
Identity = 49/153 (32.03%), Postives = 70/153 (45.75%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            V SV +  DG+     S D T  V+   R KFL  L  H    R   +SP D R++ SAS D  V + D   +    +   H  +V  VD  P G  I     D TVK+WD+     +Q    H+  V  +SF P G  +V+ S D ++ + +
Sbjct:  106 VRSVHFCSDGQSFVTASDDKTVKVWSTHRQKFLFSLSQHINWVRCAKFSP-DGRLIVSASDDKTVKLWDKTSRECVHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDVRTHRLLQHYQLHSAAVNALSFHPSGNYLVTASSDSTLKILD 257          

HSP 2 Score: 73.1738 bits (178), Expect = 2.343e-12
Identity = 48/153 (31.37%), Postives = 73/153 (47.71%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            V SV +S + +++A GSMD    V+ +      +   GH      + +SP    +L S S D  V I     K   T    H   V SV    DG +  T S D+TVK+W  + +  + S++ H + V    F P G  +VS SDDK++ L++
Sbjct:   22 VTSVDFSLNTKQLASGSMDSCLMVWHMKPQTRAYRFAGHKDAVTCVNFSP-SGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSFVTASDDKTVKVWSTHRQKFLFSLSQHINWVRCAKFSPDGRLIVSASDDKTVKLWD 173          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WD51B_PONAB (WD repeat-containing protein 51B OS=Pongo abelii GN=WDR51B PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.504e-14
Identity = 57/185 (30.81%), Postives = 88/185 (47.57%), Query Frame = 3
Query:  108 NLIATLSIXRPEGLKPTDKXSS-KKF------VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            NL+A+ S  R   L   DK     +F      V SV +S DG+ +A  S D +  V+ + R +FL+ L  H    R   +SP D R++ S S D  + I D   K      S    +   VD +P G  I +  SD+TVK+WD+ +   +Q    H+  V  +SF P    +V+ S D ++ + +
Sbjct:   73 NLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFLATASEDKSIKVWSMYRQRFLYSLYRHTHWVRCAKFSP-DGRLIVSCSEDKTIKIWDTTNKQCVNNFSDSVGFANFVDFNPSGTCIASAGSDQTVKVWDVRVNKLLQHYQVHSGGVNCISFHPSDNYLVTASSDGTLKILD 256          

HSP 2 Score: 69.707 bits (169), Expect = 2.591e-11
Identity = 44/156 (28.21%), Postives = 76/156 (48.72%), Query Frame = 3
Query:  174 KKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            K  + S+  SP+G+++A  S D    +++       +   GH      + +SP    +L SAS D  V +   + +   +    H   V SVD S DG  + T S D+++K+W +  +  + S+  HT  V    F P G  +VS S+DK+I +++
Sbjct:   18 KAAITSLDLSPNGKQLATASWDTFLMLWNFKPHARAYRYVGHKDVVTSVQFSP-HGNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFLATASEDKSIKVWSMYRQRFLYSLYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIWD 172          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WD51A_MOUSE (WD repeat-containing protein 51A OS=Mus musculus GN=Wdr51a PE=2 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 4.270e-14
Identity = 47/153 (30.72%), Postives = 70/153 (45.75%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            V SV +  DG+ +   S D T  V+   R +FL  L  H    R   +SP D R++ SAS D  V + D   +    +   H  +V  VD  P G  I     D TVK+WD      +Q    H+  V  +SF P G  +++ S D ++ + +
Sbjct:  106 VRSVHFCSDGQSLVTASDDKTVKVWSTHRQRFLFSLTQHINWVRCAKFSP-DGRLIVSASDDKTVKLWDKTSRECIHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDARTHRLLQHYQLHSAAVNALSFHPSGNYLITASSDSTLKILD 257          

HSP 2 Score: 75.485 bits (184), Expect = 4.722e-13
Identity = 48/153 (31.37%), Postives = 73/153 (47.71%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            V  V +S + + +A GSMD T  ++ +      +   GH      + +SP    +L S S D  V I     K   T    H   V SV    DG ++ T S D+TVK+W  + +  + S+T H + V    F P G  +VS SDDK++ L++
Sbjct:   22 VTCVDFSLNTKHLASGSMDSTLMIWHMKPQSRAYRFTGHKDAVTCVNFSP-SGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSLVTASDDKTVKVWSTHRQRFLFSLTQHINWVRCAKFSPDGRLIVSASDDKTVKLWD 173          

HSP 3 Score: 68.9366 bits (167), Expect = 4.419e-11
Identity = 51/182 (28.02%), Postives = 76/182 (41.76%), Query Frame = 3
Query:  174 KKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS***GIFKVRLLQSFCLLFENANAI 719
            K  V  V +SP G  +A GS D T  ++             H    R + +   D + L +AS D  V +     +    +++ H  WV     SPDG  I + S D+TVKLWD   R  + S   H   V  V F P G  + +   D ++ +++          RLLQ + L     NA+
Sbjct:   61 KDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCS-DGQSLVTASDDKTVKVWSTHRQRFLFSLTQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKTSRECIHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDAR------THRLLQHYQLHSAAVNAL 235          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: YQ95_SCHPO (Uncharacterized WD repeat-containing protein C18.05c OS=Schizosaccharomyces pombe GN=SPCC18.05c PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 7.284e-14
Identity = 42/119 (35.29%), Postives = 62/119 (52.10%), Query Frame = 3
Query:  156 TDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLW 512
            T     +K V   ++SPDGR IA  S D +  ++D    KFL  L GH        +S  D R+L S+S DT + + D   K +   + GH   V +VD SPDG  + +G +D+ V++W
Sbjct:  383 TKMHGHQKVVNHASFSPDGRCIATASFDSSVRLWDGKTGKFLATLRGHVAAVYQCAWS-TDSRLLVSSSQDTTLKVWDVRSKKMKFDLPGHEDQVFAVDWSPDGQRVASGGADKAVRIW 500          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: RCO1_NEUCR (Transcriptional repressor rco-1 OS=Neurospora crassa GN=rco-1 PE=4 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 7.284e-14
Identity = 50/158 (31.65%), Postives = 80/158 (50.63%), Query Frame = 3
Query:  180 FVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLN--MRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS 647
            ++ SV +SPDG+ +A G+ D    V+D+      +   GH      L +S  D R + S S D  V + D E     T++      V +V  SPD   +  GS D++V++WD+   +   ++    H D V+ V+F P G  +VS S DK+I ++E S
Sbjct:  346 YIRSVCFSPDGKYLATGAEDKLIRVWDIQSRTIRNTFHGHEQDIYSLDFSR-DGRTIASGSGDRTVRLWDIE-TGQNTSVLSIEDGVTTVAISPDKQFVAAGSLDKSVRVWDMRGYLAERLEGPDGHKDSVYSVAFSPDGRNLVSGSLDKTIKMWELS 501          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB2_DROME (Guanine nucleotide-binding protein subunit beta-2 OS=Drosophila melanogaster GN=Gbeta76C PE=1 SV=3)

HSP 1 Score: 78.1814 bits (191), Expect = 7.284e-14
Identity = 56/194 (28.87%), Postives = 80/194 (41.24%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTR---------AKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WDT T N +  + +                +V++VA+SP G  +ACG MD   +V+DV            K L   EG     R L     D   L + S D  +   D E        +GHA  +  +  SPD     TGS D+T KLWD+      Q    H   V  V + P G    S S+D++  +Y+
Sbjct:   85 IWDTWTANKVQIIPLR-------------SAWVMTVAFSPSGNFVACGGMDNQCTVYDVNNRDASGVAKMVKELMGYEGFLSSCRFL-----DDGHLITGSGDMKICHWDLEKGVKTMDFNGHAGDIAGLSLSPDMKTYITGSVDKTAKLWDVREEGHKQMFFGHDMDVSSVCYHPSGFGFASCSEDQTARMYD 260          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: KTNB1_DANRE (Katanin p80 WD40-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 9.514e-14
Identity = 55/179 (30.73%), Postives = 81/179 (45.25%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDD 620
            +LWD     ++ TL                K  + S+ + P G  +A GS+D    ++DV R   +   +GH    R L +SP D + L SAS D+ V + D     + T  + H   V  V   P+   + +GS+DRTVKLWDL     + S    T  V  V F P G  + S S++
Sbjct:   88 RLWDLEAAKILRTLM-------------GHKASISSLDFHPMGEYLASGSVDSNIKLWDVRRKGCVFRYKGHTQAVRCLAFSP-DGKWLASASDDSTVKLWDLIAGKMITEFTSHTSAVNVVQFHPNEYLLASGSADRTVKLWDLEKFNMIGSSEGETGVVRSVLFNPDGSCLYSGSEN 252          

HSP 2 Score: 77.411 bits (189), Expect = 1.243e-13
Identity = 46/150 (30.67%), Postives = 72/150 (48.00%), Query Frame = 3
Query:  192 VAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            + ++    R+  GS+ G+  ++D+  AK L  L GH      L + P+    L S S D+++ + D   K       GH   V  +  SPDG  + + S D TVKLWDL     +   T+HT  V  V F P    + S S D+++ L++
Sbjct:   69 IQFNSSEERVVAGSLSGSLRLWDLEAAKILRTLMGHKASISSLDFHPMG-EYLASGSVDSNIKLWDVRRKGCVFRYKGHTQAVRCLAFSPDGKWLASASDDSTVKLWDLIAGKMITEFTSHTSAVNVVQFHPNEYLLASGSADRTVKLWD 217          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB4_HUMAN (Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3)

HSP 1 Score: 77.7962 bits (190), Expect = 9.514e-14
Identity = 49/189 (25.93%), Postives = 85/189 (44.97%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVT----RAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WD+ T N +  + +                +V++ A++P G  +ACG +D   S++++       +    L GH        +  +D   + ++S DT   + D E     T  +GH+  V+S+  SPD     +G+ D + KLWD+      QS T H   +  VSF P G    + SDD +  L++
Sbjct:   81 IWDSYTTNKMHAIPLR-------------SSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELPGHTGYLSCCRF--LDDSQIVTSSGDTTCALWDIETAQQTTTFTGHSGDVMSLSLSPDMRTFVSGACDASSKLWDIRDGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFD 254          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: Y163_SYNY3 (Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803) GN=sll0163 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.243e-13
Identity = 50/155 (32.26%), Postives = 79/155 (50.97%), Query Frame = 3
Query:  174 KKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLY 638
            + +V +  WSPDG+ I   S DGT  V+     K L  L GH        +S +D + + + S D    +   EG +L T + GH   V   D S DG  + T S+D+T + WD++ +  + ++T H+  V    F P G R+++VS DK+  L+
Sbjct: 1219 QNWVNNALWSPDGQHIITSSSDGTARVWS-RHGKCLGTLRGHDHNIHGARFS-LDGQKIVTYSTDNTARLWTKEG-TLLTILRGHQKEVYDADFSADGRFVFTVSADQTARQWDISQKDTI-TLTGHSHWVRNAHFNPKGDRLLTVSRDKTARLW 1369          
The following BLAST results are available for this feature:
BLAST of DC900382 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 138
Match NameE-valueIdentityDescription
WD51B_HUMAN5.045e-1530.81WD repeat-containing protein 51B OS=Homo sapiens G... [more]
WD51A_BOVIN1.124e-1432.03WD repeat-containing protein 51A OS=Bos taurus GN=... [more]
WD51B_PONAB2.504e-1430.81WD repeat-containing protein 51B OS=Pongo abelii G... [more]
WD51A_MOUSE4.270e-1430.72WD repeat-containing protein 51A OS=Mus musculus G... [more]
YQ95_SCHPO7.284e-1435.29Uncharacterized WD repeat-containing protein C18.0... [more]
RCO1_NEUCR7.284e-1431.65Transcriptional repressor rco-1 OS=Neurospora cras... [more]
GBB2_DROME7.284e-1428.87Guanine nucleotide-binding protein subunit beta-2 ... [more]
KTNB1_DANRE9.514e-1430.73Katanin p80 WD40-containing subunit B1 OS=Danio re... [more]
GBB4_HUMAN9.514e-1425.93Guanine nucleotide-binding protein subunit beta-4 ... [more]
Y163_SYNY31.243e-1332.26Uncharacterized WD repeat-containing protein sll01... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900382 VSS Citrus sinensis cDNA clone VS28955 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900382 ID=DC900382|Name=DC900382|organism=Citrus sinensis|type=EST|length=905bp
TCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTC
TCTCTCTCCTCGTGCCGAATTCGGCACGAGGNAAAGCTCTGGGACACAGC
CACTTGGAATCTGATTGCCACCCTGTCAATTNCTCGNCCAGAAGGACTGA
AGCCGACAGATAAAAGNAGCAGCAAGAAGTTTGTTCTATCAGTTGCATGG
AGTCCTGATGGCAGACGAATTGCTTGTGGNTCAATGGATGGCACAATNTC
TGTTTTTGATGTTACCCGCGCCAAATTCCTGCATNATCTGGAAGGCCATT
TCATGCCTGNGCGTNCTCTTGTTTATTCCCCTGTTGATCCACGTGTNCTC
TTCTCTGCATCANATGATACTCATGTGCACATTNATGATGCTGAGGGTAA
AAGTCTGGNTACGGCAATGTCTGGTCATGCTAGNTGGGTGTTGAGTGTTG
ATGCAAGCCCCGATGGAGCAGCTATTACAACAGGCTCAAGTGATAGAACT
GTAAAGCTCTGGGATCTTAACATGAGAGCAGCCATGCAGTCAATGACTAA
CCACACAGACCAGGTCTGGGGAGTGTCATTTAGACCACTAGGAGGTCGGG
TTGTTAGCGTATCAGATGACAAAAGCATATCACTCTATGAATACTCCTGA
TGATAAGGCATTTTCAAAGTAAGACTATTGCAAAGTTTTTGTTTGTTATT
TGAAAATGCTAATGCTATTGTTGTTCTTAACTGCATTGGTCTGAAATTGT
ATGCCNTTCCAACCTANATTAGTCTTCNGCNTANCNTGNTTTTTTGANCA
TTTTCATCATCTNAAAAAANCCGACATTTGGNGGACTGATGTCTAGTAGT
TGNGCNCAAGTAGTTGGCATGGTGGTAAAGTGNCTTCCCCCTTTGCTTTG
GATGC
back to top