DC900382

Overview
NameDC900382
Unique NameDC900382
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length905
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900382_ssr1 microsatellite DC900382_ssr1:1..58. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: TUP1_YEAST (General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae GN=TUP1 PE=1 SV=2)

HSP 1 Score: 77.411 bits (189), Expect = 1.243e-13
Identity = 58/174 (33.33%), Postives = 82/174 (47.13%), Query Frame = 3
Query:  141 EGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASP-DGAAITTGSSDRTVKLWDL-------NMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLY 638
            E L  +   SS  ++ SV +SPDG+ +A G+ D    ++D+   K +  L+GH      L Y P   + L S S D  V I D         +S     V +V  SP DG  I  GS DR V++WD         + +  +S T H D V+ V F   G  VVS S D+S+ L+
Sbjct:  432 ENLNTSSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDK-LVSGSGDRTVRIWDLRTGQCSLTLS-IEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLW 603          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB4_RAT (Guanine nucleotide-binding protein subunit beta-4 OS=Rattus norvegicus GN=Gnb4 PE=2 SV=4)

HSP 1 Score: 77.0258 bits (188), Expect = 1.623e-13
Identity = 49/189 (25.93%), Postives = 85/189 (44.97%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVT----RAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WD+ T N +  + +                +V++ A++P G  +ACG +D   S++++       +    L GH        +  +D   + ++S DT   + D E     T  +GH+  V+S+  SPD     +G+ D + KLWD+      QS T H   +  VSF P G    + SDD +  L++
Sbjct:   81 IWDSYTTNKMHAIPLR-------------SSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELPGHTGYLSCCRF--LDDGQIITSSGDTTCALWDIETGQQTTTFTGHSGDVMSLSLSPDLKTFVSGACDASSKLWDIRDGMCRQSFTGHISDINAVSFFPSGYAFATGSDDATCRLFD 254          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB4_MOUSE (Guanine nucleotide-binding protein subunit beta-4 OS=Mus musculus GN=Gnb4 PE=2 SV=4)

HSP 1 Score: 77.0258 bits (188), Expect = 1.623e-13
Identity = 49/189 (25.93%), Postives = 85/189 (44.97%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVT----RAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WD+ T N +  + +                +V++ A++P G  +ACG +D   S++++       +    L GH        +  +D   + ++S DT   + D E     T  +GH+  V+S+  SPD     +G+ D + KLWD+      QS T H   +  VSF P G    + SDD +  L++
Sbjct:   81 IWDSYTTNKMHAIPLR-------------SSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELPGHTGYLSCCRF--LDDGQIITSSGDTTCALWDIETGQQTTTFTGHSGDVMSLSLSPDLKTFVSGACDASSKLWDIRDGMCRQSFTGHISDINAVSFFPSGYAFATGSDDATCRLFD 254          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR69_RAT (WD repeat-containing protein 69 OS=Rattus norvegicus GN=Wdr69 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.119e-13
Identity = 49/188 (26.06%), Postives = 84/188 (44.68%), Query Frame = 3
Query:   75 HEXKLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLY 638
            H   +WD +T   + TL     E             + S  +S D   I  GSMD T  ++D T  K +  L GH        +     +++ +AS D    + +A  +   T + GH   +  +  +P G  + TGSSD+T ++WD+     +Q +  HTD+++  +F   G  V++ S D S  ++
Sbjct:  241 HTVVVWDASTGRKVHTLIGHCAE-------------ISSALFSWDCSLILTGSMDKTCMLWDATSGKCVATLTGHDDEILDSCFDYTG-KLIATASADGTARVYNATTRKCITKLEGHEGEISKISFNPQGNRLLTGSSDKTARIWDVQTGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNSCRIW 414          

HSP 2 Score: 72.0182 bits (175), Expect = 5.220e-12
Identity = 46/186 (24.73%), Postives = 84/186 (45.16%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            KLWD  +   + TL+    E             ++S+++   G RI  GS D T  V+D +  + +H L GH       ++S  D  ++ + S D    + DA        ++GH   +L       G  I T S+D T ++++   R  +  +  H  ++  +SF P G R+++ S DK+  +++
Sbjct:  202 KLWDIQSGEEVVTLTGHLAE-------------IISLSFDTSGDRIITGSFDHTVVVWDASTGRKVHTLIGHCAEISSALFS-WDCSLILTGSMDKTCMLWDATSGKCVATLTGHDDEILDSCFDYTGKLIATASADGTARVYNATTRKCITKLEGHEGEISKISFNPQGNRLLTGSSDKTARIWD 373          

HSP 3 Score: 70.4774 bits (171), Expect = 1.519e-11
Identity = 40/153 (26.14%), Postives = 70/153 (45.75%), Query Frame = 3
Query:  189 SVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS 647
            +VA +  G     GS D T  V+D    + LH LEGH      + ++      + + S D    +  AE         GH   ++ +  +P    + TGS D T KLWD+     + ++T H  ++  +SF   G R+++ S D ++ +++ S
Sbjct:   97 NVALNKAGSCFITGSYDRTCKVWDTASGEELHTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLSFNPQSTVVATGSMDTTAKLWDIQSGEEVVTLTGHLAEIISLSFDTSGDRIITGSFDHTVVVWDAS 249          

HSP 4 Score: 67.781 bits (164), Expect = 9.845e-11
Identity = 47/187 (25.13%), Postives = 82/187 (43.85%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWS-PDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            K+WDTA+   + TL                +  V ++A++ P G +IA GS D T  ++     K  H   GH      L ++P    V+ + S DT   + D +       ++GH   ++S+     G  I TGS D TV +WD +    + ++  H  ++    F      +++ S DK+  L++
Sbjct:  117 KVWDTASGEELHTLE-------------GHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLSFNP-QSTVVATGSMDTTAKLWDIQSGEEVVTLTGHLAEIISLSFDTSGDRIITGSFDHTVVVWDASTGRKVHTLIGHCAEISSALFSWDCSLILTGSMDKTCMLWD 289          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR38_MOUSE (WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.119e-13
Identity = 51/156 (32.69%), Postives = 77/156 (49.36%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTN---HTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            V S  +SPDGR IA  S D +  ++DV R+K LH L+GH      + +SP D + L S   D    + + +       + GH   + S D SP   ++ TGS D TV +WDL     + S  N   HT  +  + +    G + S S DK+I +++
Sbjct:   71 VKSCCFSPDGRLIASSSSDHSIRLWDVARSKCLHVLKGHQRSVETVSFSP-DSKQLASGGWDKRAIVWEVQSGRRVHLLVGHCDSIQSSDFSPTSDSLATGSWDSTVHIWDLRASTPVVSYHNLEGHTGNISCLCY-SASGLLASGSWDKTICVWK 224          

HSP 2 Score: 71.633 bits (174), Expect = 6.818e-12
Identity = 39/149 (26.17%), Postives = 68/149 (45.64%), Query Frame = 3
Query:  195 AWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            A+SPDGR +   S DG   V+     + L  L GH  P +   +SP D R++ S+S D  + + D         + GH   V +V  SPD   + +G  D+   +W++     +  +  H D +    F P    + + S D ++ +++
Sbjct:   33 AFSPDGRTLLTASDDGCVYVWGTKSGRLLWRLAGHRGPVKSCCFSP-DGRLIASSSSDHSIRLWDVARSKCLHVLKGHQRSVETVSFSPDSKQLASGGWDKRAIVWEVQSGRRVHLLVGHCDSIQSSDFSPTSDSLATGSWDSTVHIWD 180          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR38_HUMAN (WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.768e-13
Identity = 50/151 (33.11%), Postives = 75/151 (49.67%), Query Frame = 3
Query:  198 WSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNM---RAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +SPDG   A  S D T  ++DV RAK L  L+GH      + +SP D R L S   D  V + D +   +   + GH   + S D SP    + TGS D TV +WDL M     + Q++  H+  +  + +    G + S S DK+I +++
Sbjct:   71 FSPDGHLFASASCDCTVRLWDVARAKCLRVLKGHQRSVETVSFSP-DSRQLASGGWDKRVMLWDVQSGQMLRLLVGHRDSIQSSDFSPTVNCLATGSWDSTVHIWDLRMVTPAVSHQALEGHSANISCLCY-SASGLLASGSWDKTIHIWK 219          

HSP 2 Score: 74.3294 bits (181), Expect = 1.052e-12
Identity = 44/153 (28.76%), Postives = 71/153 (46.41%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            V S A+SPDG+ +  GS DG    ++    + L  L GH  P +   +SP D  +  SAS D  V + D         + GH   V +V  SPD   + +G  D+ V LWD+     ++ +  H D +    F P    + + S D ++ +++
Sbjct:   24 VNSSAFSPDGQMLLTGSEDGCVYGWETRSGQLLWRLGGHTGPVKFCRFSP-DGHLFASASCDCTVRLWDVARAKCLRVLKGHQRSVETVSFSPDSRQLASGGWDKRVMLWDVQSGQMLRLLVGHRDSIQSSDFSPTVNCLATGSWDSTVHIWD 175          

HSP 3 Score: 68.5514 bits (166), Expect = 5.772e-11
Identity = 48/151 (31.79%), Postives = 69/151 (45.70%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFD---VTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKS 626
            + S  +SP    +A GS D T  ++D   VT A     LEGH      L YS     +L S S D  +HI      SL   + GH  WV S+  SPD   + +    R VK+WD N    ++++    D     +F P G  +VS + D++
Sbjct:  150 IQSSDFSPTVNCLATGSWDSTVHIWDLRMVTPAVSHQALEGHSANISCLCYSASG--LLASGSWDKTIHIWKPTTSSLLIQLKGHVTWVKSIAFSPDELWLASAGYSRMVKVWDCNTGKCLETLKGVLDVAHTCAFTPDGKILVSGAADQT 298          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: NLE1_BOVIN (Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 3.615e-13
Identity = 44/133 (33.08%), Postives = 72/133 (54.14%), Query Frame = 3
Query:  120 TLSIXRP-EGLKPTDKXSSKKFVLS-VAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLW 512
            TL +  P E  KP  + +  + +++ V +SPD R IA  S D +  ++D    K+L  L GH      + +S  D R+L S S D+ + + D + + L T + GHA  V +VD SPDG  + +G  D+ +++W
Sbjct:  352 TLFLWSPAEDKKPLARMTGHQALINQVVFSPDSRVIASASFDKSIKLWDGRTGKYLASLRGHVAAVYQIAWS-ADSRLLVSGSSDSTLKVWDVKAQKLSTDLPGHADEVYAVDWSPDGQRVASGGKDKCLRIW 483          

HSP 2 Score: 73.1738 bits (178), Expect = 2.343e-12
Identity = 44/142 (30.99%), Postives = 69/142 (48.59%), Query Frame = 3
Query:  216 RIACGSMDGTXSVFDVTRAKF-LHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLY 638
            R+  GS D T  ++     K  L  + GH      +V+SP D RV+ SAS D  + + D        ++ GH   V  +  S D   + +GSSD T+K+WD+  +     +  H D+V+ V + P G RV S   DK + ++
Sbjct:  343 RLVSGSDDFTLFLWSPAEDKKPLARMTGHQALINQVVFSP-DSRVIASASFDKSIKLWDGRTGKYLASLRGHVAAVYQIAWSADSRLLVSGSSDSTLKVWDVKAQKLSTDLPGHADEVYAVDWSPDGQRVASGGKDKCLRIW 483          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: MUT11_CHLRE (Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 3.615e-13
Identity = 49/158 (31.01%), Postives = 83/158 (52.53%), Query Frame = 3
Query:  177 KFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAA---ITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            K V +V +SPDG  +A GS D T +++D      ++ L GH      + ++P + R L +A+ D  + + DAE  +    ++GH  +V   +   DGAA   + +GS D T++LWD+     ++ +  H+D V   +F   G  VV+ S D  I L++
Sbjct:   41 KAVAAVKFSPDGSLLASGSADRTVALWDAATGARVNTLAGHSCGVSDVAWNP-NGRYLATAADDHSLKLWDAETGACLRTLTGHTNYVFCCNF--DGAAGHLLASGSFDETLRLWDVRSGRCLREVPAHSDPVTSAAFSYDGSMVVTSSLDGLIRLWD 195          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: TUP1_CANAL (Transcriptional repressor TUP1 OS=Candida albicans GN=TUP1 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 4.722e-13
Identity = 50/164 (30.49%), Postives = 79/164 (48.17%), Query Frame = 3
Query:  168 SSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDL-------NMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLY 638
            S   ++ SV +SPDG+ +A G+ D    ++D++  + +  L GH      L + P   R L S S D  V I D         +S     V +V  SPDG  I  GS DRTV++WD         + +  ++   H D V+ V+F   G ++ S S D+++ L+
Sbjct:  255 SGDLYIRSVCFSPDGKLLATGAEDKLIRIWDLSTKRIIKILRGHEQDIYSLDFFPDGDR-LVSGSGDRSVRIWDLRTSQCSLTLS-IEDGVTTVAVSPDGKLIAAGSLDRTVRVWDSTTGFLVERLDSGNENGNGHEDSVYSVAFSNNGEQIASGSLDRTVKLW 416          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB2_RAT (Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4)

HSP 1 Score: 75.485 bits (184), Expect = 4.722e-13
Identity = 45/189 (23.81%), Postives = 84/189 (44.44%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVT----RAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WD+ T N +  + +                +V++ A++P G  +ACG +D   S++ +       +    L GH        +  +D   + ++S DT   + D E        +GH+  V+S+  +PDG    +G+ D ++KLWD+      Q+   H   +  V+F P G    + SDD +  L++
Sbjct:   81 IWDSYTTNKVHAIPLR-------------SSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRF--LDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFD 254          
The following BLAST results are available for this feature:
BLAST of DC900382 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 138
Match NameE-valueIdentityDescription
TUP1_YEAST1.243e-1333.33General transcriptional corepressor TUP1 OS=Saccha... [more]
GBB4_RAT1.623e-1325.93Guanine nucleotide-binding protein subunit beta-4 ... [more]
GBB4_MOUSE1.623e-1325.93Guanine nucleotide-binding protein subunit beta-4 ... [more]
WDR69_RAT2.119e-1326.06WD repeat-containing protein 69 OS=Rattus norvegic... [more]
WDR38_MOUSE2.119e-1332.69WD repeat-containing protein 38 OS=Mus musculus GN... [more]
WDR38_HUMAN2.768e-1333.11WD repeat-containing protein 38 OS=Homo sapiens GN... [more]
NLE1_BOVIN3.615e-1333.08Notchless protein homolog 1 OS=Bos taurus GN=NLE1 ... [more]
MUT11_CHLRE3.615e-1331.01Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut1... [more]
TUP1_CANAL4.722e-1330.49Transcriptional repressor TUP1 OS=Candida albicans... [more]
GBB2_RAT4.722e-1323.81Guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900382 VSS Citrus sinensis cDNA clone VS28955 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900382 ID=DC900382|Name=DC900382|organism=Citrus sinensis|type=EST|length=905bp
TCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTC
TCTCTCTCCTCGTGCCGAATTCGGCACGAGGNAAAGCTCTGGGACACAGC
CACTTGGAATCTGATTGCCACCCTGTCAATTNCTCGNCCAGAAGGACTGA
AGCCGACAGATAAAAGNAGCAGCAAGAAGTTTGTTCTATCAGTTGCATGG
AGTCCTGATGGCAGACGAATTGCTTGTGGNTCAATGGATGGCACAATNTC
TGTTTTTGATGTTACCCGCGCCAAATTCCTGCATNATCTGGAAGGCCATT
TCATGCCTGNGCGTNCTCTTGTTTATTCCCCTGTTGATCCACGTGTNCTC
TTCTCTGCATCANATGATACTCATGTGCACATTNATGATGCTGAGGGTAA
AAGTCTGGNTACGGCAATGTCTGGTCATGCTAGNTGGGTGTTGAGTGTTG
ATGCAAGCCCCGATGGAGCAGCTATTACAACAGGCTCAAGTGATAGAACT
GTAAAGCTCTGGGATCTTAACATGAGAGCAGCCATGCAGTCAATGACTAA
CCACACAGACCAGGTCTGGGGAGTGTCATTTAGACCACTAGGAGGTCGGG
TTGTTAGCGTATCAGATGACAAAAGCATATCACTCTATGAATACTCCTGA
TGATAAGGCATTTTCAAAGTAAGACTATTGCAAAGTTTTTGTTTGTTATT
TGAAAATGCTAATGCTATTGTTGTTCTTAACTGCATTGGTCTGAAATTGT
ATGCCNTTCCAACCTANATTAGTCTTCNGCNTANCNTGNTTTTTTGANCA
TTTTCATCATCTNAAAAAANCCGACATTTGGNGGACTGATGTCTAGTAGT
TGNGCNCAAGTAGTTGGCATGGTGGTAAAGTGNCTTCCCCCTTTGCTTTG
GATGC
back to top