DC900382

Overview
NameDC900382
Unique NameDC900382
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length905
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900382_ssr1 microsatellite DC900382_ssr1:1..58. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB2_MOUSE (Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3)

HSP 1 Score: 75.485 bits (184), Expect = 4.722e-13
Identity = 45/189 (23.81%), Postives = 84/189 (44.44%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVT----RAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WD+ T N +  + +                +V++ A++P G  +ACG +D   S++ +       +    L GH        +  +D   + ++S DT   + D E        +GH+  V+S+  +PDG    +G+ D ++KLWD+      Q+   H   +  V+F P G    + SDD +  L++
Sbjct:   81 IWDSYTTNKVHAIPLR-------------SSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRF--LDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFD 254          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB2_HUMAN (Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3)

HSP 1 Score: 75.485 bits (184), Expect = 4.722e-13
Identity = 45/189 (23.81%), Postives = 84/189 (44.44%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVT----RAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WD+ T N +  + +                +V++ A++P G  +ACG +D   S++ +       +    L GH        +  +D   + ++S DT   + D E        +GH+  V+S+  +PDG    +G+ D ++KLWD+      Q+   H   +  V+F P G    + SDD +  L++
Sbjct:   81 IWDSYTTNKVHAIPLR-------------SSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRF--LDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFD 254          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB2_BOVIN (Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3)

HSP 1 Score: 75.485 bits (184), Expect = 4.722e-13
Identity = 45/189 (23.81%), Postives = 84/189 (44.44%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVT----RAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WD+ T N +  + +                +V++ A++P G  +ACG +D   S++ +       +    L GH        +  +D   + ++S DT   + D E        +GH+  V+S+  +PDG    +G+ D ++KLWD+      Q+   H   +  V+F P G    + SDD +  L++
Sbjct:   81 IWDSYTTNKVHAIPLR-------------SSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRF--LDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFD 254          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: KTNB1_ARATH (Katanin p80 WD40 repeat-containing subunit B1 homolog 1 OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3)

HSP 1 Score: 75.0998 bits (183), Expect = 6.167e-13
Identity = 53/187 (28.34%), Postives = 81/187 (43.32%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEY 644
            KLWD     ++ TL+  R                +SV + P G   A GS+D    ++D+ +   +H  +GH      L ++P D R + S   D  V + D     L T    H   + S+D  P    + TGS+DRTVK WDL     + S    T  V  +SF P  G+ V     +S+ ++ +
Sbjct:   84 KLWDLEEAKIVRTLTGHRSN-------------CISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTP-DGRWVVSGGEDNIVKVWDLTAGKLLTEFKSHEGQIQSLDFHPHEFLLATGSADRTVKFWDLETFELIGSGGPETAGVRCLSFNP-DGKTVLCGLQESLKIFSW 255          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB1_RAT (Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4)

HSP 1 Score: 75.0998 bits (183), Expect = 6.167e-13
Identity = 45/189 (23.81%), Postives = 83/189 (43.92%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVT----RAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WD+ T N +  + +                +V++ A++P G  +ACG +D   S++++       +    L GH        +  +D   + ++S DT   + D E     T  +GH   V+S+  +PD     +G+ D + KLWD+      Q+ T H   +  + F P G    + SDD +  L++
Sbjct:   81 IWDSYTTNKVHAIPLR-------------SSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRF--LDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFD 254          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB1_PONAB (Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3)

HSP 1 Score: 75.0998 bits (183), Expect = 6.167e-13
Identity = 45/189 (23.81%), Postives = 83/189 (43.92%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVT----RAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WD+ T N +  + +                +V++ A++P G  +ACG +D   S++++       +    L GH        +  +D   + ++S DT   + D E     T  +GH   V+S+  +PD     +G+ D + KLWD+      Q+ T H   +  + F P G    + SDD +  L++
Sbjct:   81 IWDSYTTNKVHAIPLR-------------SSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRF--LDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFD 254          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB1_MOUSE (Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3)

HSP 1 Score: 75.0998 bits (183), Expect = 6.167e-13
Identity = 45/189 (23.81%), Postives = 83/189 (43.92%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVT----RAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WD+ T N +  + +                +V++ A++P G  +ACG +D   S++++       +    L GH        +  +D   + ++S DT   + D E     T  +GH   V+S+  +PD     +G+ D + KLWD+      Q+ T H   +  + F P G    + SDD +  L++
Sbjct:   81 IWDSYTTNKVHAIPLR-------------SSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRF--LDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFD 254          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB1_HUMAN (Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3)

HSP 1 Score: 75.0998 bits (183), Expect = 6.167e-13
Identity = 45/189 (23.81%), Postives = 83/189 (43.92%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVT----RAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WD+ T N +  + +                +V++ A++P G  +ACG +D   S++++       +    L GH        +  +D   + ++S DT   + D E     T  +GH   V+S+  +PD     +G+ D + KLWD+      Q+ T H   +  + F P G    + SDD +  L++
Sbjct:   81 IWDSYTTNKVHAIPLR-------------SSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRF--LDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFD 254          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB1_DANRE (Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 6.167e-13
Identity = 45/189 (23.81%), Postives = 83/189 (43.92%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVT----RAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WD+ T N +  + +                +V++ A++P G  +ACG +D   S++++       +    L GH        +  +D   + ++S DT   + D E     T  +GH   V+S+  +PD     +G+ D + KLWD+      Q+ T H   +  + F P G    + SDD +  L++
Sbjct:   81 IWDSYTTNKVHAIPLR-------------SSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRF--LDDNQIVTSSGDTTCALWDIETGQQTTTFAGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFD 254          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB1_CANFA (Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis familiaris GN=GNB1 PE=2 SV=3)

HSP 1 Score: 75.0998 bits (183), Expect = 6.167e-13
Identity = 45/189 (23.81%), Postives = 83/189 (43.92%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVT----RAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WD+ T N +  + +                +V++ A++P G  +ACG +D   S++++       +    L GH        +  +D   + ++S DT   + D E     T  +GH   V+S+  +PD     +G+ D + KLWD+      Q+ T H   +  + F P G    + SDD +  L++
Sbjct:   81 IWDSYTTNKVHAIPLR-------------SSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRF--LDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFD 254          
The following BLAST results are available for this feature:
BLAST of DC900382 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 138
Match NameE-valueIdentityDescription
GBB2_MOUSE4.722e-1323.81Guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
GBB2_HUMAN4.722e-1323.81Guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
GBB2_BOVIN4.722e-1323.81Guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
KTNB1_ARATH6.167e-1328.34Katanin p80 WD40 repeat-containing subunit B1 homo... [more]
GBB1_RAT6.167e-1323.81Guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
GBB1_PONAB6.167e-1323.81Guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
GBB1_MOUSE6.167e-1323.81Guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
GBB1_HUMAN6.167e-1323.81Guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
GBB1_DANRE6.167e-1323.81Guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
GBB1_CANFA6.167e-1323.81Guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900382 VSS Citrus sinensis cDNA clone VS28955 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900382 ID=DC900382|Name=DC900382|organism=Citrus sinensis|type=EST|length=905bp
TCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTC
TCTCTCTCCTCGTGCCGAATTCGGCACGAGGNAAAGCTCTGGGACACAGC
CACTTGGAATCTGATTGCCACCCTGTCAATTNCTCGNCCAGAAGGACTGA
AGCCGACAGATAAAAGNAGCAGCAAGAAGTTTGTTCTATCAGTTGCATGG
AGTCCTGATGGCAGACGAATTGCTTGTGGNTCAATGGATGGCACAATNTC
TGTTTTTGATGTTACCCGCGCCAAATTCCTGCATNATCTGGAAGGCCATT
TCATGCCTGNGCGTNCTCTTGTTTATTCCCCTGTTGATCCACGTGTNCTC
TTCTCTGCATCANATGATACTCATGTGCACATTNATGATGCTGAGGGTAA
AAGTCTGGNTACGGCAATGTCTGGTCATGCTAGNTGGGTGTTGAGTGTTG
ATGCAAGCCCCGATGGAGCAGCTATTACAACAGGCTCAAGTGATAGAACT
GTAAAGCTCTGGGATCTTAACATGAGAGCAGCCATGCAGTCAATGACTAA
CCACACAGACCAGGTCTGGGGAGTGTCATTTAGACCACTAGGAGGTCGGG
TTGTTAGCGTATCAGATGACAAAAGCATATCACTCTATGAATACTCCTGA
TGATAAGGCATTTTCAAAGTAAGACTATTGCAAAGTTTTTGTTTGTTATT
TGAAAATGCTAATGCTATTGTTGTTCTTAACTGCATTGGTCTGAAATTGT
ATGCCNTTCCAACCTANATTAGTCTTCNGCNTANCNTGNTTTTTTGANCA
TTTTCATCATCTNAAAAAANCCGACATTTGGNGGACTGATGTCTAGTAGT
TGNGCNCAAGTAGTTGGCATGGTGGTAAAGTGNCTTCCCCCTTTGCTTTG
GATGC
back to top