DC900381

Overview
NameDC900381
Unique NameDC900381
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length656
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10814 contig Csv1_Contig10814:273..927. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UB2G2_BOVIN (Ubiquitin-conjugating enzyme E2 G2 OS=Bos taurus GN=UBE2G2 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 1.798e-22
Identity = 48/78 (61.54%), Postives = 61/78 (78.21%), Query Frame = 1
Query:   34 NGRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAAKEWRDRRDDFKKKVGXCVRRS 267
            +GRVCISILH PGDDP GYE ++ERW PV +VE I+LS++SML+ PNDES ANV+A+K WRD R+ F K     V++S
Sbjct:   85 DGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKVAKQIVQKS 162          

HSP 2 Score: 22.7126 bits (47), Expect = 1.798e-22
Identity = 6/10 (60.00%), Postives = 10/10 (100.00%), Query Frame = 3
Query:    6 EIWHPNVYPE 35
            E++HPN+YP+
Sbjct:   76 EMFHPNIYPD 85          
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UB2G2_PONAB (Ubiquitin-conjugating enzyme E2 G2 OS=Pongo abelii GN=UBE2G2 PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.340e-22
Identity = 48/78 (61.54%), Postives = 61/78 (78.21%), Query Frame = 1
Query:   34 NGRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAAKEWRDRRDDFKKKVGXCVRRS 267
            +GRVCISILH PGDDP GYE ++ERW PV +VE I+LS++SML+ PNDES ANV+A+K WRD R+ F K     V++S
Sbjct:   85 DGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKS 162          

HSP 2 Score: 22.7126 bits (47), Expect = 2.340e-22
Identity = 6/10 (60.00%), Postives = 10/10 (100.00%), Query Frame = 3
Query:    6 EIWHPNVYPE 35
            E++HPN+YP+
Sbjct:   76 EMFHPNIYPD 85          
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UB2G2_MOUSE (Ubiquitin-conjugating enzyme E2 G2 OS=Mus musculus GN=Ube2g2 PE=1 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.340e-22
Identity = 48/78 (61.54%), Postives = 61/78 (78.21%), Query Frame = 1
Query:   34 NGRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAAKEWRDRRDDFKKKVGXCVRRS 267
            +GRVCISILH PGDDP GYE ++ERW PV +VE I+LS++SML+ PNDES ANV+A+K WRD R+ F K     V++S
Sbjct:   85 DGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKS 162          

HSP 2 Score: 22.7126 bits (47), Expect = 2.340e-22
Identity = 6/10 (60.00%), Postives = 10/10 (100.00%), Query Frame = 3
Query:    6 EIWHPNVYPE 35
            E++HPN+YP+
Sbjct:   76 EMFHPNIYPD 85          
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UB2G2_HUMAN (Ubiquitin-conjugating enzyme E2 G2 OS=Homo sapiens GN=UBE2G2 PE=1 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.340e-22
Identity = 48/78 (61.54%), Postives = 61/78 (78.21%), Query Frame = 1
Query:   34 NGRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAAKEWRDRRDDFKKKVGXCVRRS 267
            +GRVCISILH PGDDP GYE ++ERW PV +VE I+LS++SML+ PNDES ANV+A+K WRD R+ F K     V++S
Sbjct:   85 DGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKS 162          

HSP 2 Score: 22.7126 bits (47), Expect = 2.340e-22
Identity = 6/10 (60.00%), Postives = 10/10 (100.00%), Query Frame = 3
Query:    6 EIWHPNVYPE 35
            E++HPN+YP+
Sbjct:   76 EMFHPNIYPD 85          
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UBC7_YEAST (Ubiquitin-conjugating enzyme E2-18 kDa OS=Saccharomyces cerevisiae GN=UBC7 PE=1 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.477e-21
Identity = 47/78 (60.26%), Postives = 59/78 (75.64%), Query Frame = 1
Query:   34 NGRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAAKEWRDRRDDFKKKVGXCVRRS 267
            NG VCISILH PGDDPN YELA ERW PV +VE I+LS++SMLS PN ES AN++A   WRD R +F+++V   + +S
Sbjct:   85 NGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWRDNRPEFERQVKLSILKS 162          

HSP 2 Score: 22.7126 bits (47), Expect = 1.477e-21
Identity = 7/10 (70.00%), Postives = 8/10 (80.00%), Query Frame = 3
Query:    3 PEIWHPNVYP 32
            P I HPN+YP
Sbjct:   75 PSILHPNIYP 84          
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UBC7_SCHPO (Ubiquitin-conjugating enzyme E2-18 kDa OS=Schizosaccharomyces pombe GN=ubc3 PE=2 SV=2)

HSP 1 Score: 98.9821 bits (245), Expect = 2.324e-20
Identity = 44/79 (55.70%), Postives = 61/79 (77.22%), Query Frame = 1
Query:   31 RNGRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAAKEWRDRRDDFKKKVGXCVRRS 267
            ++G VCISILH PGDDPN YE +SERW PV +VE I+LS++SML+ PNDES AN++A K WR+ R+++ + V    R++
Sbjct:   85 KDGTVCISILHAPGDDPNMYESSSERWSPVQSVEKILLSVMSMLAEPNDESGANIDACKMWREDREEYCRVVRRLARKT 163          
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UB2R2_RABIT (Ubiquitin-conjugating enzyme E2 R2 OS=Oryctolagus cuniculus GN=UBE2R2 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 2.106e-15
Identity = 40/72 (55.56%), Postives = 51/72 (70.83%), Query Frame = 1
Query:   34 NGRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAA---KEWRDRRDDFKK 240
            NG VCISILHPP DDP   EL SERW P   V +I+LS+IS+L+ PN  SPANV+A+   ++WRD +   K+
Sbjct:   89 NGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKE 160          

HSP 2 Score: 21.557 bits (44), Expect = 2.106e-15
Identity = 5/8 (62.50%), Postives = 8/8 (100.00%), Query Frame = 3
Query:    6 EIWHPNVY 29
            ++WHPN+Y
Sbjct:   80 KMWHPNIY 87          
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UB2R2_MOUSE (Ubiquitin-conjugating enzyme E2 R2 OS=Mus musculus GN=Ube2r2 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 2.106e-15
Identity = 40/72 (55.56%), Postives = 51/72 (70.83%), Query Frame = 1
Query:   34 NGRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAA---KEWRDRRDDFKK 240
            NG VCISILHPP DDP   EL SERW P   V +I+LS+IS+L+ PN  SPANV+A+   ++WRD +   K+
Sbjct:   89 NGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKE 160          

HSP 2 Score: 21.557 bits (44), Expect = 2.106e-15
Identity = 5/8 (62.50%), Postives = 8/8 (100.00%), Query Frame = 3
Query:    6 EIWHPNVY 29
            ++WHPN+Y
Sbjct:   80 KMWHPNIY 87          
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UB2R2_HUMAN (Ubiquitin-conjugating enzyme E2 R2 OS=Homo sapiens GN=UBE2R2 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 2.106e-15
Identity = 40/72 (55.56%), Postives = 51/72 (70.83%), Query Frame = 1
Query:   34 NGRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAA---KEWRDRRDDFKK 240
            NG VCISILHPP DDP   EL SERW P   V +I+LS+IS+L+ PN  SPANV+A+   ++WRD +   K+
Sbjct:   89 NGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKE 160          

HSP 2 Score: 21.557 bits (44), Expect = 2.106e-15
Identity = 5/8 (62.50%), Postives = 8/8 (100.00%), Query Frame = 3
Query:    6 EIWHPNVY 29
            ++WHPN+Y
Sbjct:   80 KMWHPNIY 87          
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UBC3_YEAST (Ubiquitin-conjugating enzyme E2-34 kDa OS=Saccharomyces cerevisiae GN=CDC34 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.007e-14
Identity = 40/81 (49.38%), Postives = 57/81 (70.37%), Query Frame = 1
Query:   31 RNGRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAAKEWRDRRDDFKKKVGXCVRRSQE 273
            R+GR+CISILH  GD P   E  +E W PV TVES+++SI+S+L  PN  SPANV+AA ++R   + +K++V   V RS++
Sbjct:   90 RDGRLCISILHQSGD-PMTDEPDAETWSPVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRVKMEVERSKQ 169          

HSP 2 Score: 21.557 bits (44), Expect = 1.007e-14
Identity = 7/9 (77.78%), Postives = 8/9 (88.89%), Query Frame = 3
Query:    3 PEIWHPNVY 29
            P I+HPNVY
Sbjct:   81 PAIYHPNVY 89          
The following BLAST results are available for this feature:
BLAST of DC900381 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
UB2G2_BOVIN1.798e-2261.54Ubiquitin-conjugating enzyme E2 G2 OS=Bos taurus G... [more]
UB2G2_PONAB2.340e-2261.54Ubiquitin-conjugating enzyme E2 G2 OS=Pongo abelii... [more]
UB2G2_MOUSE2.340e-2261.54Ubiquitin-conjugating enzyme E2 G2 OS=Mus musculus... [more]
UB2G2_HUMAN2.340e-2261.54Ubiquitin-conjugating enzyme E2 G2 OS=Homo sapiens... [more]
UBC7_YEAST1.477e-2160.26Ubiquitin-conjugating enzyme E2-18 kDa OS=Saccharo... [more]
UBC7_SCHPO2.324e-2055.70Ubiquitin-conjugating enzyme E2-18 kDa OS=Schizosa... [more]
UB2R2_RABIT2.106e-1555.56Ubiquitin-conjugating enzyme E2 R2 OS=Oryctolagus ... [more]
UB2R2_MOUSE2.106e-1555.56Ubiquitin-conjugating enzyme E2 R2 OS=Mus musculus... [more]
UB2R2_HUMAN2.106e-1555.56Ubiquitin-conjugating enzyme E2 R2 OS=Homo sapiens... [more]
UBC3_YEAST1.007e-1449.38Ubiquitin-conjugating enzyme E2-34 kDa OS=Saccharo... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900381 VSS Citrus sinensis cDNA clone VS28953 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900381 ID=DC900381|Name=DC900381|organism=Citrus sinensis|type=EST|length=656bp
CACCAGAGATTTGGCATCCTAATGTCTATCCGGAATGGGCGTGTCTGCAT
ATCAATCCTTCATCCTCCAGGTGACGACCCTAATGGATATGAGCTTGCAA
GTGAGCGCTGGATGCCTGTTCATACTGTTGAAAGTATCGTTTTGAGTATC
ATATCAATGCTTTCCGGTCCTAATGATGAATCTCCTGCAAATGTCGAAGC
TGCAAAAGAATGGAGAGACAGGAGAGATGACTTCAAGAAGAAAGTAGGCC
NCTGTGTGAGAAGATCNCAAGAAATGTTGTAATCCAACTGCAGGCACTCT
TTTTTTCTCTACCTATGTGTTTGTACGGGAAATGTCTTGATTTAATTGTG
TGGGGGGAACTGGGTTCTGTGGGTAATGTCAATGTGCTTGGTCTTGTGTA
GACTGGCATTTTGAAGTTCTCTCAACCATCTCTCTCGTTTTCTCTGCATG
GTCAAGTCNCTGTAACGACTGGGAACATCCATGTATTCAAAAGCGNNNTT
TGGTTAGTTTTAATCNCAAATGTTCTGTCATTCTCTTAAGTTCGTGTGGA
GATTGCTCTACTCAGAATGGCTTGTGGTTTGATTTCAAAAGGATTCCCCC
GTGATATTTGCTGCTTTTGAATCTTACCGAGCCCNCAAGCATTAGATGTT
TTCTTT
back to top