DC900380

Overview
NameDC900380
Unique NameDC900380
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length695
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3221 contig Csv1_Contig3221:51..745. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_PYRAB (50S ribosomal protein L24P OS=Pyrococcus abyssi GN=rpl24p PE=3 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.846e-18
Identity = 45/98 (45.92%), Postives = 69/98 (70.41%), Query Frame = 1
Query:   76 SSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVI 369
            S   RK RK  + AP  +R+ +M+APLS +LR+KY +R++PVR  D+V+++RG +KG EGKVV+V  +++ I++E  T  K NG+ V   I+PS V+I
Sbjct:    5 SKQPRKQRKFLYNAPLHLRQKMMAAPLSKELREKYKIRNLPVRVGDKVRIMRGDFKGHEGKVVEVDLKRYRIYVEGATLRKTNGTEVFYPIHPSNVMI 102          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_KORCO (50S ribosomal protein L24P OS=Korarchaeum cryptofilum (strain OPF8) GN=rpl24p PE=3 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.846e-18
Identity = 46/94 (48.94%), Postives = 66/94 (70.21%), Query Frame = 1
Query:   91 KNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            K RK  + AP   R  +MSAPLS +L+ KY + S+P+RK D V+V+RG Y+G EG+V+ V R+++ I ++ I R K +G+ V V I+PSKVVIT
Sbjct:   10 KQRKYLYNAPIHHRGKIMSAPLSEELKSKYGINSIPIRKGDRVKVMRGDYRGTEGEVISVDRKRYRIAVKGIVRRKADGTEVPVPIHPSKVVIT 103          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_METKA (50S ribosomal protein L24P OS=Methanopyrus kandleri GN=rpl24p PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 5.371e-18
Identity = 48/98 (48.98%), Postives = 67/98 (68.37%), Query Frame = 1
Query:   76 SSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVI 369
            SS  RK RKA F AP   R+ LMSA L  +LR+K+N RS+PVR+ D V+++RG +KG EG+VV+V  ++  I++E  T E+ NG  V   I+PS V+I
Sbjct:    6 SSQPRKQRKAFFNAPLHKRQKLMSATLHPELRKKFNRRSLPVRRGDMVRIMRGDFKGHEGEVVEVDLKRLRIYVEGATIERANGEKVYYPIHPSNVMI 103          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_AERPE (50S ribosomal protein L24P OS=Aeropyrum pernix GN=rpl24p PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 5.371e-18
Identity = 49/98 (50.00%), Postives = 69/98 (70.41%), Query Frame = 1
Query:   76 SSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVI 369
            S   RK R+A + AP   R+ L+SA LS +LR+KY VRS+PVRK D+V+V+RG +KG EGKVV+V  R+  I+I+ +T  K +G+ V   I+PS V+I
Sbjct:    7 SRQPRKQRRALYRAPLHARQKLVSATLSPELREKYGVRSLPVRKGDKVRVMRGDFKGHEGKVVKVDLRRLRIYIDGVTVTKADGTPVFRPIHPSNVMI 104          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_STAMF (50S ribosomal protein L24P OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / F1) GN=rpl24p PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.041e-17
Identity = 45/98 (45.92%), Postives = 67/98 (68.37%), Query Frame = 1
Query:   76 SSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVI 369
            SS   K RKA F  P  +R  L +APLS +LR+KY V+ +PVRK D V+++RG +KG EGKVV++  R+  +++E + R+K + + V   I+PSKV+I
Sbjct:    6 SSKPSKQRKALFNMPLHLRHKLFNAPLSKELREKYGVKKLPVRKGDVVRIMRGDWKGHEGKVVRIDLRRVRLYVEGVQRKKADQTPVYYPIHPSKVMI 103          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_HYPBU (50S ribosomal protein L24P OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403) GN=rpl24p PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.728e-16
Identity = 46/98 (46.94%), Postives = 63/98 (64.29%), Query Frame = 1
Query:   76 SSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVI 369
            SS  RK R+A F AP   R+ LM+APLS +LR++Y +RS+PVR  DEV ++RG +KG  GKVV+V  R+  I +E +T     G      I+PS V+I
Sbjct:    6 SSQPRKQRRALFNAPLHKRQKLMAAPLSPELRKQYGIRSLPVRVGDEVVIMRGDFKGHRGKVVRVDLRRMRIFVEGVTITNARGEPRYYPIHPSNVMI 103          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_METTH (50S ribosomal protein L24P OS=Methanobacterium thermoautotrophicum GN=rpl24p PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 2.257e-16
Identity = 42/99 (42.42%), Postives = 69/99 (69.70%), Query Frame = 1
Query:   73 VSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVI 369
            +S   RK RK  + AP   RR +MSA LS +LR++Y  RS+P+RK D+V+++RG ++G EGKV +V  +++ +++E  T +KV+G+TV   ++PS + I
Sbjct:    1 MSKQPRKQRKYIYEAPLHARRKMMSANLSRELREEYGRRSLPLRKGDKVEILRGDFRGHEGKVEKVDLKRYRVYVEGATIQKVDGTTVYFPLHPSNLRI 99          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_METS3 (50S ribosomal protein L24P OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rpl24p PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.259e-15
Identity = 45/99 (45.45%), Postives = 62/99 (62.63%), Query Frame = 1
Query:   73 VSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVI 369
            +S   RK RKA + AP+  R   MSA LS DLR     RS+P+RK D+VQV+RG +KG EG V+ V    + I IE +T  K +G+ V + ++PS V+I
Sbjct:    1 MSKQPRKQRKALYNAPAHARGKHMSATLSKDLRADIGKRSLPIRKGDKVQVLRGDFKGHEGAVLGVDYGSYKITIEEVTLSKPDGTAVFLPVDPSNVMI 99          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_IGNH4 (50S ribosomal protein L24P OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rpl24p PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.256e-15
Identity = 43/99 (43.43%), Postives = 61/99 (61.62%), Query Frame = 1
Query:   76 SSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            S    K RK  + AP  +R   M+APLS +LR+KY V+ +PVRK D V++VRG ++G EG V +V  +K  I+++  T E   G      I+PSKV+IT
Sbjct:    6 SKKPSKQRKFLYNAPLHLRHKFMNAPLSKELREKYGVKRLPVRKGDTVKIVRGKFRGHEGTVAKVDLKKARIYVDGATIENSRGEQRFYPIHPSKVIIT 104          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_SULAC (50S ribosomal protein L24P OS=Sulfolobus acidocaldarius GN=rpl24p PE=3 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 5.558e-15
Identity = 40/100 (40.00%), Postives = 68/100 (68.00%), Query Frame = 1
Query:   73 VSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            +SS   K RK  +  P+ +R  L++A LS DL ++Y ++ + +RK D V+++RG+  G EGKVV+V R++  + IE +T++K +G+ V V ++ SKV+IT
Sbjct:    2 ISSKPSKQRKLVYNLPNHLRYKLLTARLSEDLEKQYGIKRISIRKGDSVKLMRGSQVGYEGKVVEVDRKRGRVAIEGLTKKKADGTPVYVWVHASKVIIT 101          
The following BLAST results are available for this feature:
BLAST of DC900380 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
RL24_PYRAB1.846e-1845.9250S ribosomal protein L24P OS=Pyrococcus abyssi GN... [more]
RL24_KORCO1.846e-1848.9450S ribosomal protein L24P OS=Korarchaeum cryptofi... [more]
RL24_METKA5.371e-1848.9850S ribosomal protein L24P OS=Methanopyrus kandler... [more]
RL24_AERPE5.371e-1850.0050S ribosomal protein L24P OS=Aeropyrum pernix GN=... [more]
RL24_STAMF2.041e-1745.9250S ribosomal protein L24P OS=Staphylothermus mari... [more]
RL24_HYPBU1.728e-1646.9450S ribosomal protein L24P OS=Hyperthermus butylic... [more]
RL24_METTH2.257e-1642.4250S ribosomal protein L24P OS=Methanobacterium the... [more]
RL24_METS33.259e-1545.4550S ribosomal protein L24P OS=Methanobrevibacter s... [more]
RL24_IGNH44.256e-1543.4350S ribosomal protein L24P OS=Ignicoccus hospitali... [more]
RL24_SULAC5.558e-1540.0050S ribosomal protein L24P OS=Sulfolobus acidocald... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900380 VSS Citrus sinensis cDNA clone VS28952 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900380 ID=DC900380|Name=DC900380|organism=Citrus sinensis|type=EST|length=695bp
CTTCCTCTAGCTGCCGCTGTTGTAAAACCCTAGGCCCAGTCCTCCACATC
CACCATGAAGTACAACCCCAGGGTGTCATCCTCTCGCCGTAAGAACCGGA
AGGCGCACTTCACCGCCCCTTCCAGCGTGCGCCGCATCTTGATGAGCGCG
CCGCTGTCCACTGACCTCCGTCAGAAGTACAACGTAAGGTCGATGCCTGT
GCGCAAGGACGACGAGGTCCAGGTTGTCCGTGGGACCTACAAGGGGCGCG
AGGGCAAAGTCGTTCAAGTGTATCGCCGGAAGTGGGTCATTCACATCGAG
CGCATCACTCGCGAGAAGGTTAATGGATCCACTGTGAATGTGGGAATCAA
CCCATCAAAGGTCGTGATCACCAAGCTCCGTCTGGACAAGGACAGGAAGT
CTTTGCTCGATCGCAAGGCCAAGGGACGTGCCGCCGCTGACAAGGAGAAG
GGTACCAAGTTCACCCCAGAGGATATTATGCAGAGTGTTGACTAATTTTT
ATAAGAGGTTGTTTTTAAAGTTTTTGTTTAATCATAGATTTTATGGATTT
AGGATGTTTTGTTTTGGCAATGTCCCTAAGATATTTCTATTGTTATTGTG
TTATGCCNTGAGGATCCGATTATGGGCTTATGTTGGAGATTTAAGATACT
TCTTTGGATTTTCTCCNCGTCGTTTCNATTTTAATTCTATATTTT
back to top