DC900380

Overview
NameDC900380
Unique NameDC900380
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length695
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3221 contig Csv1_Contig3221:51..745. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_METAC (50S ribosomal protein L24P OS=Methanosarcina acetivorans GN=rpl24p PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 8.874e-13
Identity = 42/100 (42.00%), Postives = 57/100 (57.00%), Query Frame = 1
Query:   73 VSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            VS   RK RKA + AP  +R+  M A LS  L ++Y  RS  V   D V+V+RG +KG EGKV  V      I ++ +   KV+G+ V   +NPS V+IT
Sbjct:    5 VSKQPRKQRKARYAAPLHIRQKFMGARLSEALTKEYGTRSAAVITGDTVKVMRGDFKGTEGKVQSVSLMDGTITVDGVISTKVDGTEVPRPLNPSNVMIT 104          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_METHJ (50S ribosomal protein L24P OS=Methanospirillum hungatei (strain JF-1 / DSM 864) GN=rpl24p PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 5.752e-12
Identity = 41/100 (41.00%), Postives = 61/100 (61.00%), Query Frame = 1
Query:   73 VSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            +SS  RK RKA + AP  +R  L+ A LS +L+ KY  RS+ V K D V+V+RG + G EG V  V  R   I ++ ++ +K +G+ V   ++PS V+IT
Sbjct:    5 ISSQPRKQRKARYNAPHHMRGSLLHAALSKELQGKYKRRSIRVIKGDTVKVLRGDHAGTEGLVDYVITRDARIVVDGVSVKKADGTEVPRPVDPSNVMIT 104          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_METLZ (50S ribosomal protein L24P OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rpl24p PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.281e-11
Identity = 40/102 (39.22%), Postives = 61/102 (59.80%), Query Frame = 1
Query:   70 RVSSSR-RKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            R+SS++ RK RK  + AP   R   + +PL++DLR+KY  RS  V   D V+V+RG +KG EG V  V  +   + +  +  +K NG  V   ++PSK++IT
Sbjct:    3 RISSTQPRKQRKFRYNAPIHTRGAFLHSPLASDLREKYGKRSFRVVTGDTVKVLRGEFKGIEGVVDGVDVKNTKVLVHGVYVKKANGEDVPRPLDPSKIMIT 104          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_METB6 (50S ribosomal protein L24P OS=Methanoregula boonei (strain 6A8) GN=rpl24p PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.186e-11
Identity = 41/99 (41.41%), Postives = 58/99 (58.59%), Query Frame = 1
Query:   76 SSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            SS  RK RKA + APS +R   ++APLS  LR+ Y  +++ V K D V+V RG + G EG V  +  R   I +  ++  KV+G+ V   I+ SKV IT
Sbjct:    6 SSQPRKQRKARYDAPSHMRSKFLNAPLSATLRETYEKKTIRVIKGDTVKVTRGDHVGEEGIVDGIDTRNVKIIVHGVSSTKVDGTEVPRPIDASKVEIT 104          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_HALMA (50S ribosomal protein L24P OS=Haloarcula marismortui GN=rpl24p PE=1 SV=3)

HSP 1 Score: 69.3218 bits (168), Expect = 2.186e-11
Identity = 39/100 (39.00%), Postives = 57/100 (57.00%), Query Frame = 1
Query:   73 VSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            +S    K RK+   AP   R   + A LS DLR++Y  R++ V   D V+V+RG + G EG+V+ V   K VIH+E +T EK +G  V   ++ S V +T
Sbjct:    1 MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVT 100          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_SULTO (50S ribosomal protein L24P OS=Sulfolobus tokodaii GN=rpl24p PE=3 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 4.869e-11
Identity = 41/102 (40.20%), Postives = 61/102 (59.80%), Query Frame = 1
Query:   73 VSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRG--TYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            VS    K R   +  P   R  L++A LS +L+Q+Y ++ + +RK D V+V+RG       EGKVV+V R+   I IE +TR+K +G+ V   I+ SKV+IT
Sbjct:    2 VSHKPSKQRLLLYNLPKHQRHKLLTAKLSKELQQQYGIKRLAIRKGDTVKVMRGDKDVLNFEGKVVEVNRKTGRIAIEGLTRKKADGTPVYRWIHASKVIIT 103          
The following BLAST results are available for this feature:
BLAST of DC900380 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
RL24_METAC8.874e-1342.0050S ribosomal protein L24P OS=Methanosarcina aceti... [more]
RL24_METHJ5.752e-1241.0050S ribosomal protein L24P OS=Methanospirillum hun... [more]
RL24_METLZ1.281e-1139.2250S ribosomal protein L24P OS=Methanocorpusculum l... [more]
RL24_METB62.186e-1141.4150S ribosomal protein L24P OS=Methanoregula boonei... [more]
RL24_HALMA2.186e-1139.0050S ribosomal protein L24P OS=Haloarcula marismort... [more]
RL24_SULTO4.869e-1140.2050S ribosomal protein L24P OS=Sulfolobus tokodaii ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900380 VSS Citrus sinensis cDNA clone VS28952 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900380 ID=DC900380|Name=DC900380|organism=Citrus sinensis|type=EST|length=695bp
CTTCCTCTAGCTGCCGCTGTTGTAAAACCCTAGGCCCAGTCCTCCACATC
CACCATGAAGTACAACCCCAGGGTGTCATCCTCTCGCCGTAAGAACCGGA
AGGCGCACTTCACCGCCCCTTCCAGCGTGCGCCGCATCTTGATGAGCGCG
CCGCTGTCCACTGACCTCCGTCAGAAGTACAACGTAAGGTCGATGCCTGT
GCGCAAGGACGACGAGGTCCAGGTTGTCCGTGGGACCTACAAGGGGCGCG
AGGGCAAAGTCGTTCAAGTGTATCGCCGGAAGTGGGTCATTCACATCGAG
CGCATCACTCGCGAGAAGGTTAATGGATCCACTGTGAATGTGGGAATCAA
CCCATCAAAGGTCGTGATCACCAAGCTCCGTCTGGACAAGGACAGGAAGT
CTTTGCTCGATCGCAAGGCCAAGGGACGTGCCGCCGCTGACAAGGAGAAG
GGTACCAAGTTCACCCCAGAGGATATTATGCAGAGTGTTGACTAATTTTT
ATAAGAGGTTGTTTTTAAAGTTTTTGTTTAATCATAGATTTTATGGATTT
AGGATGTTTTGTTTTGGCAATGTCCCTAAGATATTTCTATTGTTATTGTG
TTATGCCNTGAGGATCCGATTATGGGCTTATGTTGGAGATTTAAGATACT
TCTTTGGATTTTCTCCNCGTCGTTTCNATTTTAATTCTATATTTT
back to top