DC900376

Overview
NameDC900376
Unique NameDC900376
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length744
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900376_ssr9 microsatellite DC900376_ssr9:9..30. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig4376 contig Csv1_Contig4376:165..904. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_PEA (Translationally-controlled tumor protein homolog OS=Pisum sativum GN=TCTP PE=2 SV=2)

HSP 1 Score: 253.447 bits (646), Expect = 9.172e-67
Identity = 126/168 (75.00%), Postives = 140/168 (83.33%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            MLVYQDLLTGDELLSDS+PYKEIENG+LWEVEGKWVV+GAVDV+IGANPS               KVVDIVD FRLQEQP FDKK F+ ++K++IKLLTPKL  E+QE FKKNIEGATK+LL KL DLQFFVGESMHDDG LVFAYYK+GA DPTFLY + ALKE+KC
Sbjct:    1 MLVYQDLLTGDELLSDSYPYKEIENGMLWEVEGKWVVKGAVDVNIGANPSAEGGEDEGVDDTAV-KVVDIVDVFRLQEQPPFDKKQFLGFVKKYIKLLTPKLEAEKQEHFKKNIEGATKYLLGKLKDLQFFVGESMHDDGSLVFAYYKDGAADPTFLYFSFALKEIKC 167          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_MEDSA (Translationally-controlled tumor protein homolog OS=Medicago sativa GN=TCTP PE=2 SV=2)

HSP 1 Score: 251.521 bits (641), Expect = 3.485e-66
Identity = 125/168 (74.40%), Postives = 139/168 (82.74%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            MLVYQDLLTGDELLSDS+PYKEIENG+LWEVEGKWV +G V+VDIGAN S               KVVDIVD FRLQEQPAFDKK F+ ++KR+IKLLTPKL  E+QE+FKK+IEGATK+LL KL DLQFFVGESMHDDG LVFAYYK+GA DPTFLY A ALKE+KC
Sbjct:    1 MLVYQDLLTGDELLSDSYPYKEIENGMLWEVEGKWVTKGVVEVDIGANASAEGGEDEGVDDTAV-KVVDIVDVFRLQEQPAFDKKQFLGFVKRYIKLLTPKLDAEKQELFKKHIEGATKYLLCKLKDLQFFVGESMHDDGSLVFAYYKDGAADPTFLYFAYALKEIKC 167          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_HORVU (Translationally-controlled tumor protein homolog OS=Hordeum vulgare GN=TCTP PE=2 SV=2)

HSP 1 Score: 250.366 bits (638), Expect = 7.765e-66
Identity = 122/168 (72.62%), Postives = 135/168 (80.36%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            MLVYQD L+GDELLSDSFPY+E+ENG+LWEV+G WVVQGAVDVDIGANPS               KVVDIVDTFRLQEQPAFDKK F+ Y+KR+IK LT KL  E  + FKKN+E ATK+LLSKL DLQFFVGESMHDDG +VFAYY+EGA DPTFLY A  LKEVKC
Sbjct:    1 MLVYQDKLSGDELLSDSFPYRELENGVLWEVDGHWVVQGAVDVDIGANPSAEGGGEDEGVDDQAVKVVDIVDTFRLQEQPAFDKKQFIAYIKRYIKNLTAKLEGEELDAFKKNVESATKYLLSKLKDLQFFVGESMHDDGSVVFAYYREGAADPTFLYFAHGLKEVKC 168          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_BRAOL (Translationally-controlled tumor protein homolog OS=Brassica oleracea GN=TCTP PE=2 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.324e-65
Identity = 122/168 (72.62%), Postives = 134/168 (79.76%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            MLVY DLLTGDELLSDSFPYKEIENGILWEVEGKW  +G V+V+IGANPS               KVVDIVDTFRLQEQP +DKK F+ Y+K++IKLLTPKL+ E+QE FKK IEGATKFLL KL D QFFVGE MHDD  +VFAYYKEGAT+PTFLY A  LKEVKC
Sbjct:    1 MLVYTDLLTGDELLSDSFPYKEIENGILWEVEGKWTTKGCVEVNIGANPSAEEGGEDEGVDDSVEKVVDIVDTFRLQEQPTYDKKGFIAYIKKYIKLLTPKLTPEQQEEFKKGIEGATKFLLPKLKDFQFFVGEGMHDDSTIVFAYYKEGATNPTFLYFAHGLKEVKC 168          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_WHEAT (Translationally-controlled tumor protein homolog OS=Triticum aestivum GN=TCTP PE=2 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 2.259e-65
Identity = 121/168 (72.02%), Postives = 137/168 (81.55%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            MLVYQD L+GDELLSDSFPY+E+ENG+LWEV+G WVVQGAVDVDIGANPS               KVVDIVDTFRLQEQPAFDKK F+++MKR+IK L+ KL  +  ++FKKN+E ATK+LLSKL DLQFFVGESMHDDG +VFAYYKEGA DPTFLY A  LKEVKC
Sbjct:    1 MLVYQDKLSGDELLSDSFPYRELENGVLWEVDGHWVVQGAVDVDIGANPSAEGGGDDEGVDDQAVKVVDIVDTFRLQEQPAFDKKQFISHMKRYIKNLSAKLEGDDLDVFKKNVESATKYLLSKLKDLQFFVGESMHDDGGVVFAYYKEGAADPTFLYFAHGLKEVKC 168          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_TOBAC (Translationally-controlled tumor protein homolog OS=Nicotiana tabacum GN=TCTP PE=2 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 5.033e-65
Identity = 122/168 (72.62%), Postives = 138/168 (82.14%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            MLVYQDLL+GDEL SDSF Y E+ NG+LWEV+GKWVVQGAVDV+IGANPS               KVVDIVDTFRLQEQP+FDKK FV YMK++IK LTPKL  E++E+FK NI+GATK+LLSKLSDLQFFVGESM DD  +VFAYYK+GATDPTFLY+A  LKEVKC
Sbjct:    1 MLVYQDLLSGDELPSDSFSYTELGNGVLWEVQGKWVVQGAVDVNIGANPSAEGADEDEGVDDQAIKVVDIVDTFRLQEQPSFDKKQFVAYMKKYIKNLTPKLGAEQEEVFKNNIQGATKYLLSKLSDLQFFVGESMADDTGMVFAYYKDGATDPTFLYLAHGLKEVKC 168          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_CUCME (Translationally-controlled tumor protein homolog OS=Cucumis melo GN=TCTP PE=2 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 3.607e-63
Identity = 119/168 (70.83%), Postives = 135/168 (80.36%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            MLVYQDL++GDELLSDSFPYKEIENG++WEVEGKWVV+GAVDVDIGANPS               KVVDIVDTFRLQEQP+ DKK F++ +K++IK LTP L  E+QE FK  IEGA K+LL K+ DLQFFVGESM DD  +VFAYYKEGATDPTFLY+A  LKEVKC
Sbjct:    1 MLVYQDLVSGDELLSDSFPYKEIENGMIWEVEGKWVVKGAVDVDIGANPSAEGGGEDEGVDDQAVKVVDIVDTFRLQEQPSMDKKVFLSCIKKYIKKLTPLLQGEQQEAFKNKIEGAVKYLLPKVKDLQFFVGESMADDSAMVFAYYKEGATDPTFLYIAPGLKEVKC 168          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_MAIZE (Translationally-controlled tumor protein homolog OS=Zea mays GN=TCTP PE=2 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 3.732e-60
Identity = 116/168 (69.05%), Postives = 131/168 (77.98%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            MLVYQDLL+GDELLSDSF YKE+ENG+LWEVEGKWV QG VDVDIGANPS               KVVDIVDTFRLQEQP FDKK FV+Y+K++IK LT  L  E+ + FKK +EGATKFLLSKL DLQFFVGESM DD  + FAYYK+GAT+ TFLY +  LKE+KC
Sbjct:    1 MLVYQDLLSGDELLSDSFTYKELENGVLWEVEGKWVTQGPVDVDIGANPSAEGGEDESVDDTAV-KVVDIVDTFRLQEQPPFDKKSFVSYIKKYIKNLTAVLEPEKADEFKKGVEGATKFLLSKLKDLQFFVGESMKDDASVAFAYYKDGATNSTFLYFSHGLKEIKC 167          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_CRYNE (Translationally-controlled tumor protein homolog OS=Cryptococcus neoformans GN=CNM01460 PE=3 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 2.985e-25
Identity = 66/170 (38.82%), Postives = 100/170 (58.82%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVK 586
            ML+YQD+LTGDE++SD+FP KEI + I +EV+   ++    DVDIG NPS               +V ++V +FRLQ   +FDKK ++TY+K ++K +  KL E   +R   F+K  +   K +++   D +F++GESM+ DG +    Y+E    P F    D LKE+K
Sbjct:    1 MLIYQDVLTGDEMISDAFPIKEIGD-IAYEVDCANIIIKEGDVDIGGNPSAEEAAEALEEGAQ--QVNNVVHSFRLQST-SFDKKSYLTYLKGYMKAIKSKLQESNPDRVAAFEKGAQDFAKKIVANFKDYEFYIGESMNPDGMVCLLNYREDGVTPYFTMWKDGLKEIK 166          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_GIBZE (Translationally-controlled tumor protein homolog OS=Gibberella zeae GN=FG02523 PE=3 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.638e-23
Identity = 67/173 (38.73%), Postives = 98/173 (56.65%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQ--EIFKKNIEGATKF----LLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVK 586
            ML+Y D+L GDEL+SDS+  KE++ GI++E +   + +GAV+V+IGAN S               KV +IV++FRLQ    FDKK ++ Y+K ++K +  KL E     E  K    GA+KF    ++ K  D +F+ GESM  DG +V   Y+E    P  ++    LKE K
Sbjct:    1 MLIYNDILNGDELISDSYDLKEVD-GIVYEADCAMIEEGAVEVNIGANASAEEAAEDLDDGAV--KVNNIVNSFRLQST-TFDKKSYLAYLKGYMKAIKAKLQENGSSAEDIKAFETGASKFVKDTIVPKFKDFEFYTGESMDPDGMVVLLNYREDGVTPYTIFWKHGLKETK 169          
The following BLAST results are available for this feature:
BLAST of DC900376 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
TCTP_PEA9.172e-6775.00Translationally-controlled tumor protein homolog O... [more]
TCTP_MEDSA3.485e-6674.40Translationally-controlled tumor protein homolog O... [more]
TCTP_HORVU7.765e-6672.62Translationally-controlled tumor protein homolog O... [more]
TCTP_BRAOL1.324e-6572.62Translationally-controlled tumor protein homolog O... [more]
TCTP_WHEAT2.259e-6572.02Translationally-controlled tumor protein homolog O... [more]
TCTP_TOBAC5.033e-6572.62Translationally-controlled tumor protein homolog O... [more]
TCTP_CUCME3.607e-6370.83Translationally-controlled tumor protein homolog O... [more]
TCTP_MAIZE3.732e-6069.05Translationally-controlled tumor protein homolog O... [more]
TCTP_CRYNE2.985e-2538.82Translationally-controlled tumor protein homolog O... [more]
TCTP_GIBZE1.638e-2338.73Translationally-controlled tumor protein homolog O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900376 VSS Citrus sinensis cDNA clone VS28946 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900376 ID=DC900376|Name=DC900376|organism=Citrus sinensis|type=EST|length=744bp
CCGCTGCGTCTCTCTCTCTCTCTCTCTCTCCAGTTTTCTCCGTTGATTAT
TTTTCTTTTTTGTGTTCGCGAGAGAGACTGCAATCATGTTGGTCTATCAA
GATCTCCTCACCGGTGATGAGCTTCTCTCCGATTCTTTTCCCTACAAGGA
AATTGAGAATGGGATTCTGTGGGAAGTTGAGGGAAAGTGGGTTGTACAAG
GAGCCGTTGATGTTGACATTGGTGCAAATCCTTCTGCCGAAGGAGCTGAT
GAGGATGAGGGTGTTGATGACCAAGCCGTGAAGGTGGTTGACATTGTCGA
CACATTCAGGCTACAGGAGCAACCCGCTTTTGACAAGAAGCCGTTTGTAA
CATACATGAAGAGATTCATCAAGTTGCTGACGCCCAAGCTGAGTGAGGAG
AGGCAGGAGATATTTAAGAAGAATATTGAGGGAGCGACCAAGTTCTTGCT
CTCGAAGCTCAGTGACCTTCAATTCTTTGTTGGGGAGAGCATGCATGATG
ATGGCTGTCTTGTCTTTGCTTACTACAAGGAAGGTGCGACCGACCCAACA
TTTTTGTATATGGCTGATGCATTGAAGGAGGTGAAGTGCTAAGCTGGGCT
TCGAAGAGGAAGTGCCTGCTGTAGTTCTAATTTTAATTATTGCCCGCGGT
TATTTTTATGTATCTTTTGTGCTGGTTTACTCGGGACTTGTGCTTGCTGT
TTTTTAGTTTTTATTTTGACATAAACAATATGTTTTTCTGCTCT
back to top