DC900376

Overview
NameDC900376
Unique NameDC900376
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length744
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900376_ssr9 microsatellite DC900376_ssr9:9..30. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig4376 contig Csv1_Contig4376:165..904. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_DROPS (Translationally-controlled tumor protein homolog OS=Drosophila pseudoobscura pseudoobscura GN=Tctp PE=3 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 7.873e-18
Identity = 57/175 (32.57%), Postives = 98/175 (56.00%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDI-GANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAF-DKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKE--GATDPTFLYMADALKEVKC 589
            M +++D++TGDE+ +D++  K +++ +++EV GK + +   ++ + GAN S                 VD+V   RL E  AF DKK +  Y+K ++K +  KL+E   ++ ++FK N+  A K +L +  +LQFF GESM  DG +    Y+E  G + P  ++    L+E KC
Sbjct:    1 MKIFKDIITGDEMFADTYKIKLVDD-VVYEVYGKLISREGSEIKLEGANASAEEADEGTDTNVESG--VDVVLNHRLVECFAFGDKKSYTLYLKDYMKKVLAKLAEKSPDQVDVFKTNMNKAMKDILGRFKELQFFTGESMDCDGMVALVEYREIDGQSIPVLMFFKHGLEEEKC 172          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_CHICK (Translationally-controlled tumor protein homolog OS=Gallus gallus GN=TPT1 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.028e-17
Identity = 56/174 (32.18%), Postives = 89/174 (51.15%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVD---IGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGAT---KFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            M++Y+D ++ DE+ SD +  +E+ NG+  EVEGK V +    +D   IG N S                V DIV    LQE  +F K+ +  Y+K ++K +  +L E + E  K  + GA    K +L+   + QFFVGE+M+ DG +    ++E    P  ++  D L+  KC
Sbjct:    1 MIIYRDCISQDEMFSDIYKIREVANGLCLEVEGKMVTRTEGQIDDSLIGGNASAEGPEGEGTEATVITGV-DIVINHHLQET-SFTKESYKKYIKDYMKAIKARLEEHKPERVKPFMTGAAEQIKHILANFKNYQFFVGENMNPDGMVALLDFREDGVTPYMIFFKDGLEIEKC 172          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_USTMA (Translationally-controlled tumor protein homolog OS=Ustilago maydis GN=UM01283 PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 2.533e-16
Identity = 52/158 (32.91%), Postives = 84/158 (53.16%), Query Frame = 2
Query:  122 LLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVK 586
            + SD +  K +E+ +++EV+   +V    DVDIGANPS               +V++IV +FRLQ    FDKK ++ Y+K ++K +  KL+E   +R   F+K      K ++   +D +FF GESM  +G +    Y+E    P  ++  D L+E K
Sbjct:    1 MCSDGYEMKLVED-VVYEVDAAKIVVSDGDVDIGANPSAEEAAEALENGAE--QVINIVHSFRLQSTQ-FDKKSYLAYLKGYMKSVKAKLAESNPDRVPAFEKGAAAFAKKIVGSFNDWEFFTGESMDPEGMVALLNYREDGVTPYLVFWKDGLRETK 154          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_THEAN (Translationally-controlled tumor protein homolog OS=Theileria annulata GN=TCTP PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 2.533e-16
Identity = 57/173 (32.95%), Postives = 88/173 (50.87%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKE-IEN----GILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKE 580
            M VY+DL + DE+ SD++ + +  +N     + +EV+   V +G  D  IG N                  VVD+VD F LQ  P   KK + +Y+K++I+ L   L E   ER E FK ++    K +L+   D +F+VGES+  +  LV+ YYK     P  +++ D L E
Sbjct:    1 MKVYRDLYSNDEVCSDAYDHLDPFDNPDLSSVAFEVKTSKVAKGEEDYGIGYNDEEGGDQMNVDPNVEV--VVDVVDKFALQSLP-LTKKDYSSYIKKYIQRLVATLQEKNPERVEPFKTSVSEFVKHVLANFDDFEFYVGESLDYEAGLVYGYYKGEEVSPRLVFLKDGLVE 170          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_THEPA (Translationally-controlled tumor protein homolog OS=Theileria parva GN=TCTP PE=3 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.257e-15
Identity = 56/173 (32.37%), Postives = 88/173 (50.87%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSF----PYKEIE-NGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKE 580
            M VY+DL + DE+ SD++    P+   + + + +EV+   V +G  D  IG N                  VVD+VD F LQ   +  KK + +Y++++I+ L   L E   ER E FK  +    K +L+   D +F+VGES+  +  LV+AYYK     P  +++ D L E
Sbjct:    1 MKVYKDLYSNDEVCSDAYDHHDPFDNADLSSVAFEVKTSKVPKGEEDYGIGYNDEEGADQMNVDPNVEM--VVDVVDKFGLQSL-SLTKKDYSSYIRKYIQRLVATLQEKNPERVEPFKTTVSDFVKHVLANFEDFEFYVGESLDYEAGLVYAYYKGEEVSPRLVFLKDGLVE 170          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_PLACH (Translationally-controlled tumor protein homolog OS=Plasmodium chabaudi GN=TCTP PE=3 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.257e-15
Identity = 56/175 (32.00%), Postives = 89/175 (50.86%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSF----PYKEIE-NGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVK 586
            M VY+D+ T DE+ SDS+    P+   E   I +EV+    ++G  D  I  N                  V+DIVD+F+L    +  KK +  Y+K F++ +   L E   +R EIFK   +   K +L+   D +F++GES+  +  L+++YYK     P F+Y++D L E K
Sbjct:    1 MKVYKDIFTNDEVCSDSYAQEDPFGNPEFREIAFEVKSNKRIKGNDDYGIADNSEDAVEGMGADVEH----VIDIVDSFQLTST-SLSKKEYSAYVKNFMQRILKHLEEKKPDRVEIFKTKAQPLIKHILTNFDDFEFYMGESLDMEAGLIYSYYKGEEITPRFVYISDGLFEEK 170          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_PLAF7 (Translationally-controlled tumor protein homolog OS=Plasmodium falciparum (isolate 3D7) GN=TCTP PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.642e-15
Identity = 55/175 (31.43%), Postives = 91/175 (52.00%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSF----PYKEIE-NGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVK 586
            M V++D+ T DE+ SDS+    P++  E   I +EV+    ++G  D  I  N                  V+DIVD+F+L    AF KK +  Y+K +++ +   L E   +R EIFK   +   K +L+   D +F++GES+  +  ++++YYK     P F+Y++D L E K
Sbjct:    1 MKVFKDVFTNDEVCSDSYVQQDPFEVPEFREIAFEVKSNKRIKGNEDYGIADNSEDAVEGMGADVEH----VIDIVDSFQLTST-AFSKKEYSAYIKNYMQKVAKYLEEKKPDRVEIFKTKAQPFIKHILTNFDDFEFYMGESLDMEAGIIYSYYKGEEITPRFVYISDGLFEEK 170          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_PLAYO (Translationally-controlled tumor protein homolog OS=Plasmodium yoelii yoelii GN=TCTP PE=3 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 2.800e-15
Identity = 55/175 (31.43%), Postives = 89/175 (50.86%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSF----PYKEIE-NGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVK 586
            M VY+D+ T DE+ SDS+    P+   E   I +EV+    ++G  D  I  N                  V+DIVD+F+L    +  KK +  Y+K F++ +   L E   +R +IFK   +   K +L+   D +F++GES+  +  L+++YYK     P F+Y++D L E K
Sbjct:    1 MKVYKDIFTNDEVCSDSYIQEDPFGNPEFREIAFEVKSNKRIKGNDDYGIADNSEDAVDGMGADVEH----VIDIVDSFQLTST-SLSKKEYSAYVKNFMQRILKHLEEKKPDRVDIFKTKAQPLIKHILTNFDDFEFYMGESLDMEAGLIYSYYKGEEITPRFVYISDGLFEEK 170          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_PLABA (Translationally-controlled tumor protein homolog OS=Plasmodium berghei (strain Anka) GN=TCTP PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.800e-15
Identity = 55/175 (31.43%), Postives = 88/175 (50.29%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSF----PYKEIE-NGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVK 586
            M VY+D+ T DE+ SDS+    P+   E   I +EV+    ++G  D  I  N                  V+DIVD+F+L    +  KK +  Y+K F++ +   L E   +R  IFK   +   K +L+   D +F++GES+  +  L+++YYK     P F+Y++D L E K
Sbjct:    1 MKVYKDIFTNDEVCSDSYIQEDPFGNAEFREIAFEVKSNKRIKGNDDYGIADNSEDAVDGMGADVEH----VIDIVDSFQLTST-SLSKKEYSAYVKNFMQRILKHLEEKKPDRVNIFKTKAQPLIKHILTNFDDFEFYMGESLDMEAGLIYSYYKGEEITPRFVYISDGLFEEK 170          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_PLAKN (Translationally-controlled tumor protein homolog OS=Plasmodium knowlesi GN=TCTP PE=1 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.064e-14
Identity = 53/175 (30.29%), Postives = 89/175 (50.86%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSF----PYKEIE-NGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVK 586
            M VY+D+ T DE+ SDS+    P+   +   I +EV+    ++G  D  I  N                 +V+DIVD+F+L    +  KK +  Y+K +++ +   L E   +R ++FK   +   K +L+   D +F++GES+  D  L ++YYK     P F+Y++D L E K
Sbjct:    1 MKVYKDVFTNDEVCSDSYNQEDPFGIADFREIAFEVKSNKRIKGNDDYGIADNSEEAVDGMGADVE----QVIDIVDSFQLTST-SLSKKEYSVYIKNYMQKILKYLEEKKPDRVDVFKTKAQPLIKHILTNFDDFEFYMGESLDMDAGLTYSYYKGEEVTPRFVYISDGLYEEK 170          
The following BLAST results are available for this feature:
BLAST of DC900376 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
TCTP_DROPS7.873e-1832.57Translationally-controlled tumor protein homolog O... [more]
TCTP_CHICK1.028e-1732.18Translationally-controlled tumor protein homolog O... [more]
TCTP_USTMA2.533e-1632.91Translationally-controlled tumor protein homolog O... [more]
TCTP_THEAN2.533e-1632.95Translationally-controlled tumor protein homolog O... [more]
TCTP_THEPA1.257e-1532.37Translationally-controlled tumor protein homolog O... [more]
TCTP_PLACH1.257e-1532.00Translationally-controlled tumor protein homolog O... [more]
TCTP_PLAF71.642e-1531.43Translationally-controlled tumor protein homolog O... [more]
TCTP_PLAYO2.800e-1531.43Translationally-controlled tumor protein homolog O... [more]
TCTP_PLABA2.800e-1531.43Translationally-controlled tumor protein homolog O... [more]
TCTP_PLAKN1.064e-1430.29Translationally-controlled tumor protein homolog O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900376 VSS Citrus sinensis cDNA clone VS28946 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900376 ID=DC900376|Name=DC900376|organism=Citrus sinensis|type=EST|length=744bp
CCGCTGCGTCTCTCTCTCTCTCTCTCTCTCCAGTTTTCTCCGTTGATTAT
TTTTCTTTTTTGTGTTCGCGAGAGAGACTGCAATCATGTTGGTCTATCAA
GATCTCCTCACCGGTGATGAGCTTCTCTCCGATTCTTTTCCCTACAAGGA
AATTGAGAATGGGATTCTGTGGGAAGTTGAGGGAAAGTGGGTTGTACAAG
GAGCCGTTGATGTTGACATTGGTGCAAATCCTTCTGCCGAAGGAGCTGAT
GAGGATGAGGGTGTTGATGACCAAGCCGTGAAGGTGGTTGACATTGTCGA
CACATTCAGGCTACAGGAGCAACCCGCTTTTGACAAGAAGCCGTTTGTAA
CATACATGAAGAGATTCATCAAGTTGCTGACGCCCAAGCTGAGTGAGGAG
AGGCAGGAGATATTTAAGAAGAATATTGAGGGAGCGACCAAGTTCTTGCT
CTCGAAGCTCAGTGACCTTCAATTCTTTGTTGGGGAGAGCATGCATGATG
ATGGCTGTCTTGTCTTTGCTTACTACAAGGAAGGTGCGACCGACCCAACA
TTTTTGTATATGGCTGATGCATTGAAGGAGGTGAAGTGCTAAGCTGGGCT
TCGAAGAGGAAGTGCCTGCTGTAGTTCTAATTTTAATTATTGCCCGCGGT
TATTTTTATGTATCTTTTGTGCTGGTTTACTCGGGACTTGTGCTTGCTGT
TTTTTAGTTTTTATTTTGACATAAACAATATGTTTTTCTGCTCT
back to top