DC900376

Overview
NameDC900376
Unique NameDC900376
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length744
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900376_ssr9 microsatellite DC900376_ssr9:9..30. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig4376 contig Csv1_Contig4376:165..904. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_XENLA (Translationally-controlled tumor protein homolog OS=Xenopus laevis GN=tpt1 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 4.044e-14
Identity = 52/173 (30.06%), Postives = 80/173 (46.24%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVV--QGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            M++Y+D +T DE+ SD +   E  +G+  EVEGK +   +GA+D  +    +                 VDIV   +LQE   F K  +  Y+K ++K L   L +   ER   F K  +   K +L    + QF+ GE M+ DG +    Y+E    P  ++  D L   KC
Sbjct:    1 MIIYKDCITEDEMFSDIYKIIETPDGMCLEVEGKVIQREEGAIDDALIGGNASAEFQEDDVGGSSLTSGVDIVMNHKLQET-GFTKDSYKNYIKDYVKQLKAHLEKTNPERVNTFMKGAQETVKKILGNFKNYQFYTGERMNPDGMVGLLDYREDGITPFMIFFKDGLIIEKC 172          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: FKSG2_HUMAN (Putative apoptosis inhibitor FKSG2 OS=Homo sapiens GN=FKSG2 PE=5 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 4.044e-14
Identity = 54/175 (30.86%), Postives = 89/175 (50.86%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVD---IGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEG---ATKFLLSKLSDLQFFVGESMHDDGCL-VFAYYKEGATDPTFLYMADALKEVKC 589
            M+++QDL++ +E+ SD +   EI NG+  EVE K + +   + D   IG N S                 VDIV    LQE   F K+ +  Y+K ++K +  KL E+R E  K  I G     K + +   + QFF+GE+++  G + +  Y K+G  DP + ++ + L+  +C
Sbjct:    1 MIIFQDLISHNEMFSDIYKIWEITNGLCLEVEQKMLSKTTGNTDDSLIGRNSSSESTEDEVTESTIITS-VDIVTNHHLQES-IFTKEAYKKYIKDYMKSINEKLEEQRPERVKLFITGNEEQIKHIFANFQNYQFFIGENLNPPGMVALLNYRKDGQYDPIYDFLRNGLEIKRC 173          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_WUCBA (Translationally-controlled tumor protein homolog OS=Wuchereria bancrofti PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 5.281e-14
Identity = 60/181 (33.15%), Postives = 90/181 (49.72%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDI-GANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAF-DKKPFVTYMKRFIKLLTPKL-----SEERQEIFKKNIEGATKFLLSK--LSDLQFFVGESMHD---DGCLVFAYYK--EGATDPTFLYMADALKEVK 586
            ML+++D  T DEL SDSFP K ++ G++WE +G+ VV+   ++ + GANPS               + +D V   RLQE   + D   F +Y K F+K +   +     SE     FK+ I+     LLSK     LQFF+GE M +   +G +    Y+  E    P  + + +AL E K
Sbjct:    1 MLIFKDAFTDDELASDSFPMKLVD-GLIWEFKGRQVVRREGEIQLAGANPSTEGEDGDEGSEECVERGIDFVLNHRLQEMNCYEDLATFKSYCKSFMKKVVELMQKNGKSEAEISEFKRKIQAWVVSLLSKDRFKQLQFFIGERMAEGQGEGQVAVVEYRDEEEGEVPYLMLVKEALVEEK 180          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_SCHJA (Translationally-controlled tumor protein homolog OS=Schistosoma japonicum GN=TCTP PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 5.281e-14
Identity = 51/172 (29.65%), Postives = 88/172 (51.16%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWV-VQGAVDVD-IGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQE---IFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVK 586
            M V++D ++GDE+ SDS    ++ N +++EV+  ++ V   +D   I ANPS               +V+D+V   RL    +FDKK +  Y+K ++K +  +L +E  E   IF+  I      +     D + ++GESM+ DG +    ++E    P F+++ D L E K
Sbjct:    1 MRVFKDAISGDEMFSDSHS-PQLINDVVYEVDANFITVSNGLDSKLIAANPSGEEGQEEVSDSTE--RVIDLVHASRLVST-SFDKKSYRAYLKGYLKAIKERLQKENPERVSIFESRINEYMVNVFKNFDDYEHYIGESMNPDGMVALMNFRENGVTPYFVFLKDGLIEEK 168          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_CAEEL (Translationally-controlled tumor protein homolog OS=Caenorhabditis elegans GN=tct-1 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 6.897e-14
Identity = 56/182 (30.77%), Postives = 96/182 (52.75%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDI-GANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAF-DKKPFVTYMKRFIKLLTPKLSEERQ-----EIFKKNIEGATKFLLSK--LSDLQFFVGESM---HDDGCLVFAYYK--EGATDPTFLYMADALKEVKC 589
            ML+Y+D+ T DEL SDSFP K +++ +++E +GK VV+   ++ + G+NPS               + +DIV   +L E   + D   F  Y+K+F+K +   + +  +     + FKK I+G    LL+K    +L FF+GE      ++G +    Y+  +G   PT + + +A+ E KC
Sbjct:    1 MLIYKDIFTDDELSSDSFPMKLVDD-LVYEFKGKHVVRKEGEIVLAGSNPSAEEGAEDDGSDEHVERGIDIVLNHKLVEMNCYEDASMFKAYIKKFMKNVIDHMEKNNRDKADVDAFKKKIQGWVVSLLAKDRFKNLAFFIGERAAEGAENGQVAIIEYRDVDGTEVPTLMLVKEAIIEEKC 181          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_CAEBR (Translationally-controlled tumor protein homolog OS=Caenorhabditis briggsae GN=tct-1 PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.177e-13
Identity = 55/182 (30.22%), Postives = 95/182 (52.20%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDI-GANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAF-DKKPFVTYMKRFIKLLTPKLSEERQ-----EIFKKNIEGATKFLLSK--LSDLQFFVGESM---HDDGCLVFAYYK--EGATDPTFLYMADALKEVKC 589
            ML+Y+D+ T DEL SDSFP K +++ +++E +G+ VV+   D+ + G+NPS               + +DIV   +L E   + D   F  Y+K+F+K +   + +  +     + FKK I+     LL+K    +L FF+GE      ++G +    Y+  +G   PT + + +A+ E KC
Sbjct:    1 MLIYKDIFTDDELSSDSFPMKLVDD-LIYEFKGRHVVRKEGDIILAGSNPSAEEGAEDEGSDEHVERGIDIVLNHKLVEMNCYEDASMFKAYIKKFMKNIIDHMEKNNRDKADVDAFKKKIQAWVVSLLAKDRFKNLAFFIGERAAEGAENGQVAIIEYRDVDGTEVPTLMLVKEAILEEKC 181          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_BRUMA (Translationally-controlled tumor protein homolog OS=Brugia malayi PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.537e-13
Identity = 60/181 (33.15%), Postives = 89/181 (49.17%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDI-GANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAF-DKKPFVTYMKRFIKLLTPKL-----SEERQEIFKKNIEGATKFLLSK--LSDLQFFVGESMHD---DGCLVFAYYK--EGATDPTFLYMADALKEVK 586
            ML+++D  T DEL SDSFP K ++ G++WE +G+ VV+   ++ + GANPS               + +D V   RLQE   + D   F +Y K F+K +   +     SE     FK+ I      LLSK     LQFF+GE M +   +G +    Y+  E    P  + + +AL E K
Sbjct:    1 MLIFKDAFTDDELASDSFPMKLVD-GLIWEFKGRQVVRREGEIQLAGANPSAEGEDGDEGSEECVERGIDFVLNHRLQEMNCYEDLVTFKSYCKSFMKKVVELMQKNGKSEAEISEFKRKIPAWVVSLLSKDRFKQLQFFIGERMAEGQGEGQVAVVEYRDEEDGEVPYLMLVKEALIEEK 180          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_IXOSC (Translationally-controlled tumor protein homolog OS=Ixodes scapularis GN=Tctp PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 7.626e-13
Identity = 55/176 (31.25%), Postives = 88/176 (50.00%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDI-GANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKN-----IEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYY---KEGATDPTFLYMADALKEVK 586
            ML+++D+LTGDE+ +DS  YK +++ I +E+E + V +   +V + GANPS                 +D+V   RL E   F K  +  Y+K + K L  K  E+ +   + N     +  A K +L ++ D+QFF+GES + DG +    Y   K G   P  ++    L E K
Sbjct:    1 MLLFKDILTGDEMFTDSVKYKLVDDCI-FEIECEHVTRKVGEVALDGANPSAEEVEEGTEEGTESG--LDLVLNMRLVET-GFSKTDYKNYLKTYTKALMDKWKEDGKSEAEVNEAKSKLTEAVKKVLPRIGDMQFFLGESSNPDGIVALLEYRPNKSGGETPVVMFFKHGLLEEK 172          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_ASPFU (Translationally-controlled tumor protein homolog OS=Aspergillus fumigatus GN=AFUA_1G16840 PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 9.960e-13
Identity = 53/179 (29.61%), Postives = 88/179 (49.16%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVE-GKWVVQGAVDVDI-GANPSXXXXXXXXXXXXXXXKVVDIVDTFRL-----QEQPAFDKKPFVTYMKRFIKLLTPKLSEE-----RQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVK 586
            M++Y+D+++GDE+LSD+F  KE++ G+L+E +  K++ +   D+ + GANPS                V DI D FRL     +E     K  F +++K ++K +  KL E+       + FKK    A K +L+   +    +G SM  D   V   ++E    P        L+E+K
Sbjct:    1 MIIYKDIISGDEVLSDNFKIKEVD-GVLYECDCRKYLKRKNEDIQLEGANPSAEEGDDDAGGDGEEVMVHDIEDQFRLVWLKTEEGMKPSKDAFKSHLKTYMKKVLAKLQEKGVPEAEIDAFKKGAPAAVKKILANYDNYDVLMGHSMDGDAMHVLIDFREDGVTPYATLWKHGLEEMK 178          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_TRIPS (Translationally-controlled tumor protein homolog OS=Trichinella pseudospiralis PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.219e-12
Identity = 60/180 (33.33%), Postives = 89/180 (49.44%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDI-GANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAF-DKKPFVTYMKRFIKLLTPKL-----SEERQEIFKKNIEGATKFLLSK--LSDLQFFVGESMH-DDGCLVFAYYKE--GATDPTFLYMADALKEVKC 589
            M++Y+DL +GDEL SD+FP K + N +++E  GK VV+   +V + GANPS                 +DIV   +L E P + D K F  ++K ++K L  K+     SEE    FKKN++     LL K    +LQFF G   +  +G L    Y++      P  + +   L   KC
Sbjct:    1 MIIYRDLFSGDELCSDTFPMK-LVNDVVFEFTGKHVVRKLGEVTLEGANPSAEEFDEGTEEQMESG--IDIVLNHQLMEMPMYQDIKIFKDWIKEYMKKLVEKMKSDGESEESISKFKKNMQEYVTSLLKKDRFKELQFFSGPGENAAEGQLAIVEYRQVSDTEQPIVMLIKQGLVVEKC 177          
The following BLAST results are available for this feature:
BLAST of DC900376 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
TCTP_XENLA4.044e-1430.06Translationally-controlled tumor protein homolog O... [more]
FKSG2_HUMAN4.044e-1430.86Putative apoptosis inhibitor FKSG2 OS=Homo sapiens... [more]
TCTP_WUCBA5.281e-1433.15Translationally-controlled tumor protein homolog O... [more]
TCTP_SCHJA5.281e-1429.65Translationally-controlled tumor protein homolog O... [more]
TCTP_CAEEL6.897e-1430.77Translationally-controlled tumor protein homolog O... [more]
TCTP_CAEBR1.177e-1330.22Translationally-controlled tumor protein homolog O... [more]
TCTP_BRUMA1.537e-1333.15Translationally-controlled tumor protein homolog O... [more]
TCTP_IXOSC7.626e-1331.25Translationally-controlled tumor protein homolog O... [more]
TCTP_ASPFU9.960e-1329.61Translationally-controlled tumor protein homolog O... [more]
TCTP_TRIPS2.219e-1233.33Translationally-controlled tumor protein homolog O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900376 VSS Citrus sinensis cDNA clone VS28946 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900376 ID=DC900376|Name=DC900376|organism=Citrus sinensis|type=EST|length=744bp
CCGCTGCGTCTCTCTCTCTCTCTCTCTCTCCAGTTTTCTCCGTTGATTAT
TTTTCTTTTTTGTGTTCGCGAGAGAGACTGCAATCATGTTGGTCTATCAA
GATCTCCTCACCGGTGATGAGCTTCTCTCCGATTCTTTTCCCTACAAGGA
AATTGAGAATGGGATTCTGTGGGAAGTTGAGGGAAAGTGGGTTGTACAAG
GAGCCGTTGATGTTGACATTGGTGCAAATCCTTCTGCCGAAGGAGCTGAT
GAGGATGAGGGTGTTGATGACCAAGCCGTGAAGGTGGTTGACATTGTCGA
CACATTCAGGCTACAGGAGCAACCCGCTTTTGACAAGAAGCCGTTTGTAA
CATACATGAAGAGATTCATCAAGTTGCTGACGCCCAAGCTGAGTGAGGAG
AGGCAGGAGATATTTAAGAAGAATATTGAGGGAGCGACCAAGTTCTTGCT
CTCGAAGCTCAGTGACCTTCAATTCTTTGTTGGGGAGAGCATGCATGATG
ATGGCTGTCTTGTCTTTGCTTACTACAAGGAAGGTGCGACCGACCCAACA
TTTTTGTATATGGCTGATGCATTGAAGGAGGTGAAGTGCTAAGCTGGGCT
TCGAAGAGGAAGTGCCTGCTGTAGTTCTAATTTTAATTATTGCCCGCGGT
TATTTTTATGTATCTTTTGTGCTGGTTTACTCGGGACTTGTGCTTGCTGT
TTTTTAGTTTTTATTTTGACATAAACAATATGTTTTTCTGCTCT
back to top