DC900376

Overview
NameDC900376
Unique NameDC900376
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length744
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900376_ssr9 microsatellite DC900376_ssr9:9..30. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig4376 contig Csv1_Contig4376:165..904. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_BRABE (Translationally-controlled tumor protein homolog OS=Branchiostoma belcheri PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 8.432e-12
Identity = 52/172 (30.23%), Postives = 83/172 (48.26%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQ-GAVDVD-IGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVK 586
            M++Y+D+++GDE+ SD++  K +++   +E+EGK   + G +D   IG N S                  +IV   RLQE   F K  +  Y+K + K +   L++   ER + FK       K ++    + QFF GE M  DG +    Y+E    P  L+  D L+E K
Sbjct:    1 MIIYKDIVSGDEMFSDAYKMKVLDD-YFYELEGKITTEKGGIDESAIGGNASAEDAVEGLEESGTTG--CNIVIAQRLQETQ-FTKAQYKVYIKDYSKKVLEYLTKNKPERVDGFKAASAAGMKRVMGNFKNWQFFTGEKMDQDGMVALMDYREDGKTPYMLFFKDGLEEEK 168          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_EMENI (Translationally-controlled tumor protein homolog OS=Emericella nidulans GN=AN0641 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 5.465e-11
Identity = 53/179 (29.61%), Postives = 83/179 (46.37%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVE-GKWVVQGAVDVDI-GANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFD---------KKPFVTYMKRFIKLLTPK-LSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVK 586
            M++Y+D+++GDE+LSD++  K ++ G+L+E +  K++ +   D ++ GANPS                V DI D FRL    A D         K    TYMK+ +K L  K   +E    FKK    A   +L    +    +GESM  D   +   ++E    P        L+E+K
Sbjct:    1 MIIYKDIISGDEVLSDTYNIKTVD-GVLYECDCRKYLKKTNEDFELEGANPSAEGGDDEGGAEGGEVMVHDIEDQFRLVWLKAEDGAKPPKDAFKGHLKTYMKKVLKALQDKGAPDETINEFKKGAPAAVNKILKNYDNYDVLMGESMDGDAMHILIDFREDGVTPYATLWKHGLEEMK 178          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_LUMRU (Translationally-controlled tumor protein homolog OS=Lumbricus rubellus GN=TCTP PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 7.138e-11
Identity = 55/172 (31.98%), Postives = 82/172 (47.67%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAV--DVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEER---QEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVK 586
            M++++D+  G EL SDSFP   + N  +++V+GK         D  IG N S                 VDIV   RL E  A  KK ++T++K ++K +  KL E +    E+F+KN++   K +L+   + Q F GESM  +G L  A  K     P   +    L E K
Sbjct:    1 MIIFKDVFPGVELFSDSFPVSLV-NETVYKVKGKLRTDTFAIDDKAIGGNASAEGGEEGTDAASKQG--VDIVMNSRLVEY-ALSKKDYMTHIKSYMKSVKDKLQETKPADSELFQKNVQPFIKEVLNDFKEYQLFCGESMGPEGML--ALMKWDGETPYMFFFKHGLDEEK 166          
The following BLAST results are available for this feature:
BLAST of DC900376 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
TCTP_BRABE8.432e-1230.23Translationally-controlled tumor protein homolog O... [more]
TCTP_EMENI5.465e-1129.61Translationally-controlled tumor protein homolog O... [more]
TCTP_LUMRU7.138e-1131.98Translationally-controlled tumor protein homolog O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900376 VSS Citrus sinensis cDNA clone VS28946 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900376 ID=DC900376|Name=DC900376|organism=Citrus sinensis|type=EST|length=744bp
CCGCTGCGTCTCTCTCTCTCTCTCTCTCTCCAGTTTTCTCCGTTGATTAT
TTTTCTTTTTTGTGTTCGCGAGAGAGACTGCAATCATGTTGGTCTATCAA
GATCTCCTCACCGGTGATGAGCTTCTCTCCGATTCTTTTCCCTACAAGGA
AATTGAGAATGGGATTCTGTGGGAAGTTGAGGGAAAGTGGGTTGTACAAG
GAGCCGTTGATGTTGACATTGGTGCAAATCCTTCTGCCGAAGGAGCTGAT
GAGGATGAGGGTGTTGATGACCAAGCCGTGAAGGTGGTTGACATTGTCGA
CACATTCAGGCTACAGGAGCAACCCGCTTTTGACAAGAAGCCGTTTGTAA
CATACATGAAGAGATTCATCAAGTTGCTGACGCCCAAGCTGAGTGAGGAG
AGGCAGGAGATATTTAAGAAGAATATTGAGGGAGCGACCAAGTTCTTGCT
CTCGAAGCTCAGTGACCTTCAATTCTTTGTTGGGGAGAGCATGCATGATG
ATGGCTGTCTTGTCTTTGCTTACTACAAGGAAGGTGCGACCGACCCAACA
TTTTTGTATATGGCTGATGCATTGAAGGAGGTGAAGTGCTAAGCTGGGCT
TCGAAGAGGAAGTGCCTGCTGTAGTTCTAATTTTAATTATTGCCCGCGGT
TATTTTTATGTATCTTTTGTGCTGGTTTACTCGGGACTTGTGCTTGCTGT
TTTTTAGTTTTTATTTTGACATAAACAATATGTTTTTCTGCTCT
back to top