DC900364

Overview
NameDC900364
Unique NameDC900364
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1050
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AP1_ARATH (Floral homeotic protein APETALA 1 OS=Arabidopsis thaliana GN=AP1 PE=1 SV=2)

HSP 1 Score: 151.754 bits (382), Expect = 6.418e-36
Identity = 85/225 (37.78%), Postives = 132/225 (58.67%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTR----IPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAMEAK--------PAEEHHHQVLDHFPFLGDQQPSSVLQL 692
            MGRG++ +KRIEN   RQVTFSKRRAGLLKK HE+SVLCDA++ L++FS  GKL +Y T+   ME+I+ER  + +        PE D       E   L+ +   L+ + R Y GEDL ++   +L  LE +L++++  +R RKN+L+ + ++ L++KE+ ++E+NS + + I+E    L  QQ   + +        P     HQ+    P++   QPS  L +
Sbjct:    1 MGRGRVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALVVFSHKGKLFEYSTDSC-MEKILERYERYSYAERQLIAPESDVNTNWSMEYNRLKAKIELLERNQRHYLGEDLQAMSPKELQNLEQQLDTALKHIRTRKNQLMYESINELQKKEKAIQEQNSMLSKQIKEREKILRAQQEQWDQQNQGHNMPPPLPPQQHQI--QHPYMLSHQPSPFLNM 222          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AGL8_SOLCO (Agamous-like MADS-box protein AGL8 homolog OS=Solanum commersonii GN=SCM1 PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.210e-34
Identity = 78/183 (42.62%), Postives = 121/183 (66.12%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTR---IP-EHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQ 590
            MGRG++ +KRIEN   RQVTFSKRR+GLLKK HE+SVLCDA++GLI+FS+ GKL +Y T+   ME+++ER  + +      +P +H S      E A L+     LQ + + Y GEDL S+   +L  LEH+L S++  +R RKN+L+ + +  L++++R L+E+N+ + + ++E    +E Q
Sbjct:    1 MGRGRVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYATDSC-MERLLERYERYSFAEKQLVPTDHTSPGSWTLENAKLKARLEVLQRNEKLYVGEDLESLNMKELQNLEHQLASALKHIRSRKNQLMHESISVLQKQDRALQEQNNQLSKKVKEREKEVEQQ 182          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AGL8_SOLLC (Agamous-like MADS-box protein AGL8 homolog OS=Solanum lycopersicum GN=TDR4 PE=2 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 2.697e-34
Identity = 76/181 (41.99%), Postives = 119/181 (65.75%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTR---IP-EHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALE 584
            MGRG++ +KRIEN   RQVTFSKRR+GLLKK HE+SVLCDA++GLI+FS+ GKL +Y  +   ME+I+ER  + +      +P +H S      E   L+     LQ + + Y GEDL S+   +L  LEH+L+S++  +R RKN+L+ + +  L++K+R L+E+N+ + + ++E   + +
Sbjct:    1 MGRGRVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYANDSC-MERILERYERYSFAEKQLVPTDHTSPVSWTLEHRKLKARLEVLQRNQKHYVGEDLESLSMKELQNLEHQLDSALKHIRSRKNQLMHESISVLQKKDRALQEQNNQLSKKVKEREKSAQ 180          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AGL8_SOLTU (Agamous-like MADS-box protein AGL8 homolog OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 3.522e-34
Identity = 76/183 (41.53%), Postives = 120/183 (65.57%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTR---IP-EHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQ 590
            MGRG++ +KRIEN   RQVTFSKRR+GLLKK HE+SVLCDA++GLI+FS+ GKL +Y  +   ME+++ER  + +      +P +H S      E A L+     LQ + + Y GEDL S+   +L  LEH+L+S++  +R RKN+L+ + +  L++++R L+E+N+ + + ++E    +  Q
Sbjct:    1 MGRGRVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYANDSC-MERLLERYERYSFAERQLVPTDHTSPGSWTLEHAKLKARLEVLQRNQKHYVGEDLESLNMKELQNLEHQLDSALKHIRSRKNQLMHESISVLQKQDRALQEQNNQLSKKVKEREKEVAQQ 182          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: CAL_ARATH (Transcription factor CAULIFLOWER OS=Arabidopsis thaliana GN=CAL PE=1 SV=3)

HSP 1 Score: 142.124 bits (357), Expect = 5.085e-33
Identity = 79/190 (41.58%), Postives = 118/190 (62.11%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIER--RLKVTGTRIPEHDSREQIFN----ELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAME 605
            MGRG++ +KRIEN   RQVTFSKRR GLLKK  E+SVLCDA++ LI+FS  GKL +Y +E   ME+++ER  R      ++   DS          E + L+ +   L+ + R Y GE+L  +   DL  LE +LE+++  +R RKN+L+ + L++L+RKE+ ++EENS + + I+E    L  +Q   E
Sbjct:    1 MGRGRVELKRIENKINRQVTFSKRRTGLLKKAQEISVLCDAEVSLIVFSHKGKLFEYSSESC-MEKVLERYERYSYAERQLIAPDSHVNAQTNWSMEYSRLKAKIELLERNQRHYLGEELEPMSLKDLQNLEQQLETALKHIRSRKNQLMNESLNHLQRKEKEIQEENSMLTKQIKERENILRTKQTQCE 189          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AGL8_ARATH (Agamous-like MADS-box protein AGL8 OS=Arabidopsis thaliana GN=AGL8 PE=1 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 6.642e-33
Identity = 75/187 (40.11%), Postives = 119/187 (63.64%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIER--RLKVTGTRIPEHD--SREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAM 602
            MGRG++ +KRIEN   RQVTFSKRR+GLLKK HE+SVLCDA++ LI+FSS GKL +Y T+   ME+I+ER  R   +  ++   D    E    E A L+     L+ + R + GEDL S+   +L  LEH+L++++  +R RKN+ + + +  L++K++ L++ N+++ + I+E       Q+  +
Sbjct:    1 MGRGRVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSSKGKLFEYSTDSC-MERILERYDRYLYSDKQLVGRDVSQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDSLSLKELQSLEHQLDAAIKSIRSRKNQAMFESISALQKKDKALQDHNNSLLKKIKEREKKTGQQEGQL 186          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AGL8_SINAL (Agamous-like MADS-box protein AGL8 homolog OS=Sinapis alba GN=AGL8 PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 8.675e-33
Identity = 75/187 (40.11%), Postives = 119/187 (63.64%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIER--RLKVTGTRIPEHD--SREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAM 602
            MGRG++ +KRIEN   RQVTFSKRR+GLLKK HE+SVLCDA++ L+IFSS GKL +Y T+   ME+I+ER  R   +  ++   D    E    E A L+     L+ + R + GEDL S+   +L  LEH+L +++  +R RKN+ + + +  L++K+++L++ N+ + + I+E      +Q+  +
Sbjct:    1 MGRGRVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALVIFSSKGKLFEYSTDSC-MEKILERYDRYLYSDKQLVGRDISQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDSLSLKELQSLEHQLHAAIKSIRSRKNQAMFESISALQKKDKVLQDHNNALLKKIKEREKNTVHQEVQL 186          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD14_ORYSJ (MADS-box transcription factor 14 OS=Oryza sativa subsp. japonica GN=MADS14 PE=1 SV=2)

HSP 1 Score: 140.969 bits (354), Expect = 1.133e-32
Identity = 77/191 (40.31%), Postives = 121/191 (63.35%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTR----IPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAMEAKP 614
            MGRGK+ +KRIEN   RQVTFSKRR+GLLKK +E+SVLCDA++ LIIFS+ GKL +Y T+   M++I+ER  + +         E D++    +E   L+ +   +Q   +   GEDL S+   +L QLE +LE+S+  +R RK++L+ + ++ L+RKE+ L+EEN  + + + E +   + Q    + +P
Sbjct:    1 MGRGKVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDAEVALIIFSTKGKLYEYATDSC-MDKILERYERYSYAEKVLISAESDTQGNWCHEYRKLKAKVETIQKCQKHLMGEDLESLNLKELQQLEQQLENSLKHIRSRKSQLMLESINELQRKEKSLQEENKVLQKELVEKQKVQKQQVQWDQTQP 190          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD14_ORYSI (MADS-box transcription factor 14 OS=Oryza sativa subsp. indica GN=MADS14 PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 1.480e-32
Identity = 77/191 (40.31%), Postives = 121/191 (63.35%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTR----IPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAMEAKP 614
            MGRGK+ +KRIEN   RQVTFSKRR+GLLKK +E+SVLCDA++ LIIFS+ GKL +Y T+   M++I+ER  + +         E D++    +E   L+ +   +Q   +   GEDL S+   +L QLE +LE+S+  +R RK++L+ + ++ L+RKE+ L+EEN  + + + E +   + Q    + +P
Sbjct:    1 MGRGKVQLKRIENTINRQVTFSKRRSGLLKKANEISVLCDAEVALIIFSTKGKLYKYATDSC-MDKILERYERYSYAEKVLISAESDTQGNWCHEYRKLKAKVETIQKCQKHLMGEDLESLNLKELQQLEQQLENSLKHIRSRKSQLMLESINELQRKEKSLQEENKVLQKELVEKQKVQKQQVQWDQTQP 190          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: SEP3_ARATH (Developmental protein SEPALLATA 3 OS=Arabidopsis thaliana GN=SEP3 PE=1 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.932e-32
Identity = 84/206 (40.78%), Postives = 120/206 (58.25%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVT-GTRIPEHDSREQIFNELA------VLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNM-YRWIQEHRAALEYQQAAMEAKPAEEHHHQVLDH 647
            MGRG++ +KRIEN   RQVTF+KRR GLLKK +ELSVLCDA++ LIIFS+ GKL ++C+    M + +ER  K   G   P   SRE +  EL+       L++    LQ + R   GEDLG +   +L+ LE +L+SS+ ++R  + + +  QL++L+ KERML E N  +  R    ++  L+      E      HHHQ   H
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSS-SMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTLRLRLADGYQMPLQLNPNQEEVDHYGRHHHQQQQH 205          
The following BLAST results are available for this feature:
BLAST of DC900364 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
AP1_ARATH6.418e-3637.78Floral homeotic protein APETALA 1 OS=Arabidopsis t... [more]
AGL8_SOLCO1.210e-3442.62Agamous-like MADS-box protein AGL8 homolog OS=Sola... [more]
AGL8_SOLLC2.697e-3441.99Agamous-like MADS-box protein AGL8 homolog OS=Sola... [more]
AGL8_SOLTU3.522e-3441.53Agamous-like MADS-box protein AGL8 homolog OS=Sola... [more]
CAL_ARATH5.085e-3341.58Transcription factor CAULIFLOWER OS=Arabidopsis th... [more]
AGL8_ARATH6.642e-3340.11Agamous-like MADS-box protein AGL8 OS=Arabidopsis ... [more]
AGL8_SINAL8.675e-3340.11Agamous-like MADS-box protein AGL8 homolog OS=Sina... [more]
MAD14_ORYSJ1.133e-3240.31MADS-box transcription factor 14 OS=Oryza sativa s... [more]
MAD14_ORYSI1.480e-3240.31MADS-box transcription factor 14 OS=Oryza sativa s... [more]
SEP3_ARATH1.932e-3240.78Developmental protein SEPALLATA 3 OS=Arabidopsis t... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900364 VSS Citrus sinensis cDNA clone VS28932 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900364 ID=DC900364|Name=DC900364|organism=Citrus sinensis|type=EST|length=1050bp
CGGCACGAGTTACAAGCAAAGCAAGAGAAAGCGAACAAGAAAAGATCAGA
ATAATGGGACGTGGGAAGATAGCGATCAAGAGGATTGAGAACCCGACGAC
GAGGCAAGTAACCTTCTCGAAACGGAGAGCTGGGCTTTTGAAGAAGACCC
ATGAACTCTCAGTGCTTTGTGATGCTCAAATTGGCCTCATCATCTTCTCA
AGTACCGGAAAATTGTGCCAGTACTGCACTGAGCCTTTCAGAATGGAGCA
AATCATTGAGAGGCGCCTCAAAGTTACAGGGACTCGCATCCCTGAGCATG
ATAGCCGGGAACAAATATTCAATGAGTTGGCGGTTCTGAGAAAAGAAACC
CGCCGCCTTCAGCTGAGTATGCGACGCTACACTGGTGAGGACTTGGGTTC
TATACCTTATGATGATCTCGATCAACTTGAACATGAGCTTGAAAGCTCTG
TTAACAAGGTCCGAGATCGCAAGAATGAGCTTCTTCAACAACAGCTGGAT
AATCTTCGTAGGAAGGAGCGAATGCTGGAGGAAGAGAACAGCAACATGTA
CCGTTGGATTCAGGAGCATAGGGCAGCATTGGAGTATCAGCAAGCTGCAA
TGGAAGCAAAGCCAGCTGAGGAGCATCATCATCAAGTCTTGGATCATTTT
CCATTCTTGGGAGATCAACAACCCAGTAGTGTGCTTCAGCTTGCAACCAA
CAGTATCCCTCATCAAATTCACCCTTATCACCATCTTCAGCTTGCTCAGC
CCAACCTTCAGGATCCCAATGTCTAGTATCAGCTTAAGAAGGATGTCCGA
AAGAGGTTGCGAAAGAGTAGATGATATAATCATTATGAAGATGACTCATA
ATTATCTCCTGGTTATTAATTACCTTATATAGTTTGCAGTAATTAAATTA
TTATTTTATGTTTTAGAAGCTACGAATGATCTGCTCGCTATGTGTGTTCC
TCATATTTATAACTCTTTGTATATGTATTGAGATATGTGACTTCAAACAA
TTGTACTGTGGTATGTTTTAGACATGAAAAAGTACTTGAATTTCTGCCGT
back to top