DC900364

Overview
NameDC900364
Unique NameDC900364
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1050
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MEF2D_RAT (Myocyte-specific enhancer factor 2D OS=Rattus norvegicus GN=Mef2d PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 2.221e-12
Identity = 43/85 (50.59%), Postives = 58/85 (68.24%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSR 308
            MGR KI I+RI +   RQVTF+KR+ GL+KK +ELSVLCD +I LIIF+ + KL QY +    M++++   LK T    P H+SR
Sbjct:    1 MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTD--MDKVL---LKYTEYNEP-HESR 79          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MEF2D_MOUSE (Myocyte-specific enhancer factor 2D OS=Mus musculus GN=Mef2d PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 2.221e-12
Identity = 43/85 (50.59%), Postives = 58/85 (68.24%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSR 308
            MGR KI I+RI +   RQVTF+KR+ GL+KK +ELSVLCD +I LIIF+ + KL QY +    M++++   LK T    P H+SR
Sbjct:    1 MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTD--MDKVL---LKYTEYNEP-HESR 79          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MEF2D_HUMAN (Myocyte-specific enhancer factor 2D OS=Homo sapiens GN=MEF2D PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 2.221e-12
Identity = 43/85 (50.59%), Postives = 58/85 (68.24%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSR 308
            MGR KI I+RI +   RQVTF+KR+ GL+KK +ELSVLCD +I LIIF+ + KL QY +    M++++   LK T    P H+SR
Sbjct:    1 MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTD--MDKVL---LKYTEYNEP-HESR 79          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MEF2A_PIG (Myocyte-specific enhancer factor 2A OS=Sus scrofa GN=MEF2A PE=2 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 3.789e-12
Identity = 36/59 (61.02%), Postives = 45/59 (76.27%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCT 230
            MGR KI I RI +   RQVTF+KR+ GL+KK +ELSVLCD +I LIIF+S+ KL QY +
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYAS 59          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MEF2B_HUMAN (Myocyte-specific enhancer factor 2B OS=Homo sapiens GN=MEF2B PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 4.949e-12
Identity = 43/85 (50.59%), Postives = 57/85 (67.06%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSR 308
            MGR KI I RI +   RQVTF+KR+ GL+KK +ELSVLCD +I LIIF+S  +L QY +    M++++   LK T    P H+SR
Sbjct:    1 MGRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSANRLFQYASTD--MDRVL---LKYTEYSEP-HESR 79          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: SRFC_DICDI (Serum factor response C OS=Dictyostelium discoideum GN=srfC PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 6.463e-12
Identity = 33/57 (57.89%), Postives = 42/57 (73.68%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQY 224
            MGR KI I++I N   RQ TF+KR+ GL+KK  ELS+LCD +I +I+FSS  KL QY
Sbjct:    3 MGRNKITIEKISNERNRQATFTKRKNGLIKKAMELSILCDCEIAMIVFSSNNKLFQY 59          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MEF2B_MOUSE (Myocyte-specific enhancer factor 2B OS=Mus musculus GN=Mef2b PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.102e-11
Identity = 43/85 (50.59%), Postives = 56/85 (65.88%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSR 308
            MGR KI I RI +   RQVTF+KR+ GL+KK +ELSVLCD  I LIIF+S  +L QY +    M++++   LK T    P H+SR
Sbjct:    1 MGRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCDIALIIFNSAQRLFQYASSD--MDRVL---LKYTEYSEP-HESR 79          
The following BLAST results are available for this feature:
BLAST of DC900364 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
MEF2D_RAT2.221e-1250.59Myocyte-specific enhancer factor 2D OS=Rattus norv... [more]
MEF2D_MOUSE2.221e-1250.59Myocyte-specific enhancer factor 2D OS=Mus musculu... [more]
MEF2D_HUMAN2.221e-1250.59Myocyte-specific enhancer factor 2D OS=Homo sapien... [more]
MEF2A_PIG3.789e-1261.02Myocyte-specific enhancer factor 2A OS=Sus scrofa ... [more]
MEF2B_HUMAN4.949e-1250.59Myocyte-specific enhancer factor 2B OS=Homo sapien... [more]
SRFC_DICDI6.463e-1257.89Serum factor response C OS=Dictyostelium discoideu... [more]
MEF2B_MOUSE1.102e-1150.59Myocyte-specific enhancer factor 2B OS=Mus musculu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900364 VSS Citrus sinensis cDNA clone VS28932 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900364 ID=DC900364|Name=DC900364|organism=Citrus sinensis|type=EST|length=1050bp
CGGCACGAGTTACAAGCAAAGCAAGAGAAAGCGAACAAGAAAAGATCAGA
ATAATGGGACGTGGGAAGATAGCGATCAAGAGGATTGAGAACCCGACGAC
GAGGCAAGTAACCTTCTCGAAACGGAGAGCTGGGCTTTTGAAGAAGACCC
ATGAACTCTCAGTGCTTTGTGATGCTCAAATTGGCCTCATCATCTTCTCA
AGTACCGGAAAATTGTGCCAGTACTGCACTGAGCCTTTCAGAATGGAGCA
AATCATTGAGAGGCGCCTCAAAGTTACAGGGACTCGCATCCCTGAGCATG
ATAGCCGGGAACAAATATTCAATGAGTTGGCGGTTCTGAGAAAAGAAACC
CGCCGCCTTCAGCTGAGTATGCGACGCTACACTGGTGAGGACTTGGGTTC
TATACCTTATGATGATCTCGATCAACTTGAACATGAGCTTGAAAGCTCTG
TTAACAAGGTCCGAGATCGCAAGAATGAGCTTCTTCAACAACAGCTGGAT
AATCTTCGTAGGAAGGAGCGAATGCTGGAGGAAGAGAACAGCAACATGTA
CCGTTGGATTCAGGAGCATAGGGCAGCATTGGAGTATCAGCAAGCTGCAA
TGGAAGCAAAGCCAGCTGAGGAGCATCATCATCAAGTCTTGGATCATTTT
CCATTCTTGGGAGATCAACAACCCAGTAGTGTGCTTCAGCTTGCAACCAA
CAGTATCCCTCATCAAATTCACCCTTATCACCATCTTCAGCTTGCTCAGC
CCAACCTTCAGGATCCCAATGTCTAGTATCAGCTTAAGAAGGATGTCCGA
AAGAGGTTGCGAAAGAGTAGATGATATAATCATTATGAAGATGACTCATA
ATTATCTCCTGGTTATTAATTACCTTATATAGTTTGCAGTAATTAAATTA
TTATTTTATGTTTTAGAAGCTACGAATGATCTGCTCGCTATGTGTGTTCC
TCATATTTATAACTCTTTGTATATGTATTGAGATATGTGACTTCAAACAA
TTGTACTGTGGTATGTTTTAGACATGAAAAAGTACTTGAATTTCTGCCGT
back to top