DC900364

Overview
NameDC900364
Unique NameDC900364
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1050
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD18_ORYSI (MADS-box transcription factor 18 OS=Oryza sativa subsp. indica GN=MADS18 PE=2 SV=2)

HSP 1 Score: 135.961 bits (341), Expect = 3.644e-31
Identity = 71/177 (40.11%), Postives = 112/177 (63.28%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVT----GTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHR 572
            MGRG + ++RIEN   RQVTFSKRR GLLKK HE+SVLCDA + LI+FS+ GKL ++ +    ME I+ER  + +        P  + +E   +E  +L+ +   LQ S R+  GE L ++   +L QLEH+LE S+  +R +KN+LL + +  L++KE+ L+ +N+ + + ++  +
Sbjct:    1 MGRGPVQLRRIENKINRQVTFSKRRNGLLKKAHEISVLCDADVALIVFSTKGKLYEFSSHS-SMEGILERYQRYSFDERAVLEPNTEDQENWGDEYGILKSKLDALQKSQRQLLGEQLDTLTIKELQQLEHQLEYSLKHIRSKKNQLLFESISELQKKEKSLKNQNNVLQKLMETEK 176          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MADS6_ORYSJ (MADS-box transcription factor 6 OS=Oryza sativa subsp. japonica GN=MADS6 PE=1 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 4.760e-31
Identity = 86/231 (37.23%), Postives = 125/231 (54.11%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQY----CTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEY---QQAAMEAKPAEEHHHQVLDHFPFLGDQQPSSVLQLATNSIPHQIHP 725
            MGRG++ +KRIEN   RQVTFSKRR GLLKK +ELSVLCDA++ LIIFSS GKL ++     T+     Q      + +   + E  S    ++E++ L+ +   LQ + R   GEDLG +   +L QLE +LE ++++ R RK +L+ +Q++ LRRKER L E N  +   ++   +   Y   QQA+       E+    +   P          LQ+     PHQ  P
Sbjct:    1 MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSAGITKTLERYQHCCYNAQDSNNALSETQS---WYHEMSKLKAKFEALQRTQRHLLGEDLGPLSVKELQQLEKQLECALSQARQRKTQLMMEQVEELRRKERQLGEINRQLKHKLEVEGSTSNYRAMQQASWAQGAVVENGAAYVQPPPHSAAMDSEPTLQI---GYPHQFVP 225          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: SOC1_ARATH (MADS-box protein SOC1 OS=Arabidopsis thaliana GN=SOC1 PE=1 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 1.060e-30
Identity = 72/169 (42.60%), Postives = 109/169 (64.50%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIP----EHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNM 548
            M RGK  +KRIEN T+RQVTFSKRR GLLKK  ELSVLCDA++ LIIFS  GKL ++ +    M+  I+R L+ T  R+       ++ + +  E A + K+  +L+ S R+  GE +G+   ++L Q+E +LE SV  +R RK ++ ++Q++ L++KE+ L  EN  +
Sbjct:    1 MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS--NMQDTIDRYLRHTKDRVSTKPVSEENMQHLKYEAANMMKKIEQLEASKRKLLGEGIGTCSIEELQQIEQQLEKSVKCIRARKTQVFKEQIEQLKQKEKALAAENEKL 167          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: PIST_ARATH (Floral homeotic protein PISTILLATA OS=Arabidopsis thaliana GN=PI PE=1 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.385e-30
Identity = 72/176 (40.91%), Postives = 110/176 (62.50%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAAL 581
            MGRGKI IKRIEN   R VTFSKRR GL+KK  E++VLCDA++ LIIF+S GK+  YC     +  ++++  K++G ++ +    E + NE+  ++KE   LQL +R   GED+ S+   +L  +EH +E  ++KVRD + E+L  +    RR E+M+ EE   +   +Q+   A+
Sbjct:    1 MGRGKIEIKRIENANNRVVTFSKRRNGLVKKAKEITVLCDAKVALIIFASNGKMIDYCCPSMDLGAMLDQYQKLSGKKLWD-AKHENLSNEIDRIKKENDSLQLELRHLKGEDIQSLNLKNLMAVEHAIEHGLDKVRDHQMEILISK----RRNEKMMAEEQRQLTFQLQQQEMAI 171          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD13_ORYSJ (MADS-box transcription factor 13 OS=Oryza sativa subsp. japonica GN=MADS13 PE=1 SV=2)

HSP 1 Score: 134.035 bits (336), Expect = 1.385e-30
Identity = 80/209 (38.28%), Postives = 124/209 (59.33%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLK------VTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEY----QQAAMEAKPAEEHHHQVLDHF 650
            MGRG+I IKRIEN T+RQVTF KRR GLLKK +ELSVLCDA++ LI+FSS G+L +Y      ++  I+R  K       +G  + E ++++    E A LR + + LQ + +   G+++ ++   +L QLE  LE  ++K+R RKNELL  +++ + ++E  L+ +N ++   I E    L+     + AAME + A     Q  + F
Sbjct:    1 MGRGRIEIKRIENTTSRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNNN-NVKATIDRYKKAHACGSTSGAPLIEVNAQQYYQQESAKLRHQIQMLQNTNKHLVGDNVSNLSLKELKQLESRLEKGISKIRARKNELLASEINYMAKREIELQNDNMDLRTKIAEEEQQLQQVTVARSAAMELQAAAAAQQQQQNPF 208          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: GLOB_ANTMA (Floral homeotic protein GLOBOSA OS=Antirrhinum majus GN=GLO PE=1 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.385e-30
Identity = 72/196 (36.73%), Postives = 124/196 (63.27%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRI--PEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNM-YRWIQEHRAALEYQQAAMEAKPAEEHHH 632
            MGRGKI IKRIEN + RQVT+SKRR G++KK  E+SVLCDA + +IIF+S+GK+ ++C+    +  +++   K++G R+  P+H   E + NE+  ++KE   +Q+ +R   GED+ ++ Y +L  LE  LE+  + +++++ E ++     +R+   M+EEEN ++ ++  Q H   +      ME++   +HHH
Sbjct:    1 MGRGKIEIKRIENSSNRQVTYSKRRNGIMKKAKEISVLCDAHVSVIIFASSGKMHEFCSPSTTLVDMLDHYHKLSGKRLWDPKH---EHLDNEINRVKKENDSMQIELRHLKGEDITTLNYKELMVLEDALENGTSALKNKQMEFVRM----MRKHNEMVEEENQSLQFKLRQMHLDPM--NDNVMESQAVYDHHH 187          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD17_ORYSJ (MADS-box transcription factor 17 OS=Oryza sativa subsp. japonica GN=MADS17 PE=1 SV=2)

HSP 1 Score: 133.65 bits (335), Expect = 1.809e-30
Identity = 77/171 (45.03%), Postives = 107/171 (62.57%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFR--MEQIIERRLKVTGTRIP----EHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNM 548
            MGRG++ +KRIEN   RQVTFSKRR GLLKK +ELSVLCDA++ LIIFSS GKL ++ +      +E+         G+       EH S    + E++ L+ +   LQ S R   GEDLG +   +L QLE +LE S+++ R RK +++ +Q+D+LRRKER L E N  +
Sbjct:    1 MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSAGINKTLEKYNSCCYNAQGSNSALAGGEHQS---WYQEMSRLKTKLECLQRSQRHMLGEDLGPLSIKELQQLEKQLEYSLSQARQRKTQIMMEQVDDLRRKERQLGELNKQL 168          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AGL1_ARATH (Agamous-like MADS-box protein AGL1 OS=Arabidopsis thaliana GN=AGL1 PE=1 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.809e-30
Identity = 94/256 (36.72%), Postives = 135/256 (52.73%), Query Frame = 3
Query:   33 EQEKIRIMGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRI---PEHDSREQIF-NELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAMEAKPAEEHHHQVLDHFPFLGDQQPSSVLQLAT---------NSIPHQIHPYHHLQLAQPNLQ 761
            + E  + +GRGKI IKRIEN T RQVTF KRR GLLKK +ELSVLCDA++ L+IFS+ G+L +Y     R    IER  K     +      ++  Q +  E + LR++ R +Q S R   GE LGS+ + +L  LE  LE  +++VR +KNELL  +++ ++++E  +E +++NMY                + AK AE              DQQ SSV+Q  T         +   H    Y  + L +PN Q
Sbjct:    9 DAESSKKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYANNSVR--GTIERYKKACSDAVNPPSVTEANTQYYQQEASKLRRQIRDIQNSNRHIVGESLGSLNFKELKNLEGRLEKGISRVRSKKNELLVAEIEYMQKRE--MELQHNNMY----------------LRAKIAEGAR--------LNPDQQESSVIQGTTVYESGVSSHDQSQHYNRNYIPVNLLEPNQQ 236          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: CMB1_DIACA (MADS-box protein CMB1 OS=Dianthus caryophyllus GN=CMB1 PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 3.085e-30
Identity = 75/179 (41.90%), Postives = 113/179 (63.13%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVT----GTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAA 578
            MGRG++ +KRIEN   RQVTF+KRR GLLKK +ELSVLCDA++ LI+FS+ GKL ++C+    M + +ER  + +     T  P  ++ E  + E   L+ +   LQ S R   GEDLG +   +L+QLEH+L+ S+ ++R  K + +  QL +L++KE ML E N  +   ++E  A+
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSTSC-MNKTLERYQRCSYGSLETSQPSKET-ESSYQEYLKLKAKVDVLQRSHRNLLGEDLGELSTKELEQLEHQLDKSLRQIRSIKTQHMLDQLADLQKKEEMLFESNRALKTKLEESCAS 177          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MADS7_ORYSJ (MADS-box transcription factor 7 OS=Oryza sativa subsp. japonica GN=MADS7 PE=1 SV=2)

HSP 1 Score: 131.724 bits (330), Expect = 6.873e-30
Identity = 75/177 (42.37%), Postives = 108/177 (61.02%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKV------TGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQE 566
            MGRG++ +KRIEN   RQVTF+KRR GLLKK +ELSVLCDA++ LIIFS+ GKL ++C+    M + +E+  K       T  +  E +  +   NE   L+     LQ + R   GEDL S+   +L+ LE +L+SS+  VR  + + L  QL  L+RKE+M+ E N  + R ++E
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTQ-SMTKTLEKYQKCSYAGPETAVQNRESEQLKASRNEYLKLKARVENLQRTQRNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEE 176          
The following BLAST results are available for this feature:
BLAST of DC900364 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
MAD18_ORYSI3.644e-3140.11MADS-box transcription factor 18 OS=Oryza sativa s... [more]
MADS6_ORYSJ4.760e-3137.23MADS-box transcription factor 6 OS=Oryza sativa su... [more]
SOC1_ARATH1.060e-3042.60MADS-box protein SOC1 OS=Arabidopsis thaliana GN=S... [more]
PIST_ARATH1.385e-3040.91Floral homeotic protein PISTILLATA OS=Arabidopsis ... [more]
MAD13_ORYSJ1.385e-3038.28MADS-box transcription factor 13 OS=Oryza sativa s... [more]
GLOB_ANTMA1.385e-3036.73Floral homeotic protein GLOBOSA OS=Antirrhinum maj... [more]
MAD17_ORYSJ1.809e-3045.03MADS-box transcription factor 17 OS=Oryza sativa s... [more]
AGL1_ARATH1.809e-3036.72Agamous-like MADS-box protein AGL1 OS=Arabidopsis ... [more]
CMB1_DIACA3.085e-3041.90MADS-box protein CMB1 OS=Dianthus caryophyllus GN=... [more]
MADS7_ORYSJ6.873e-3042.37MADS-box transcription factor 7 OS=Oryza sativa su... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900364 VSS Citrus sinensis cDNA clone VS28932 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900364 ID=DC900364|Name=DC900364|organism=Citrus sinensis|type=EST|length=1050bp
CGGCACGAGTTACAAGCAAAGCAAGAGAAAGCGAACAAGAAAAGATCAGA
ATAATGGGACGTGGGAAGATAGCGATCAAGAGGATTGAGAACCCGACGAC
GAGGCAAGTAACCTTCTCGAAACGGAGAGCTGGGCTTTTGAAGAAGACCC
ATGAACTCTCAGTGCTTTGTGATGCTCAAATTGGCCTCATCATCTTCTCA
AGTACCGGAAAATTGTGCCAGTACTGCACTGAGCCTTTCAGAATGGAGCA
AATCATTGAGAGGCGCCTCAAAGTTACAGGGACTCGCATCCCTGAGCATG
ATAGCCGGGAACAAATATTCAATGAGTTGGCGGTTCTGAGAAAAGAAACC
CGCCGCCTTCAGCTGAGTATGCGACGCTACACTGGTGAGGACTTGGGTTC
TATACCTTATGATGATCTCGATCAACTTGAACATGAGCTTGAAAGCTCTG
TTAACAAGGTCCGAGATCGCAAGAATGAGCTTCTTCAACAACAGCTGGAT
AATCTTCGTAGGAAGGAGCGAATGCTGGAGGAAGAGAACAGCAACATGTA
CCGTTGGATTCAGGAGCATAGGGCAGCATTGGAGTATCAGCAAGCTGCAA
TGGAAGCAAAGCCAGCTGAGGAGCATCATCATCAAGTCTTGGATCATTTT
CCATTCTTGGGAGATCAACAACCCAGTAGTGTGCTTCAGCTTGCAACCAA
CAGTATCCCTCATCAAATTCACCCTTATCACCATCTTCAGCTTGCTCAGC
CCAACCTTCAGGATCCCAATGTCTAGTATCAGCTTAAGAAGGATGTCCGA
AAGAGGTTGCGAAAGAGTAGATGATATAATCATTATGAAGATGACTCATA
ATTATCTCCTGGTTATTAATTACCTTATATAGTTTGCAGTAATTAAATTA
TTATTTTATGTTTTAGAAGCTACGAATGATCTGCTCGCTATGTGTGTTCC
TCATATTTATAACTCTTTGTATATGTATTGAGATATGTGACTTCAAACAA
TTGTACTGTGGTATGTTTTAGACATGAAAAAGTACTTGAATTTCTGCCGT
back to top