DC900364

Overview
NameDC900364
Unique NameDC900364
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1050
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MADS7_ORYSI (MADS-box transcription factor 7 OS=Oryza sativa subsp. indica GN=MADS7 PE=2 SV=2)

HSP 1 Score: 131.724 bits (330), Expect = 6.873e-30
Identity = 75/177 (42.37%), Postives = 108/177 (61.02%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKV------TGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQE 566
            MGRG++ +KRIEN   RQVTF+KRR GLLKK +ELSVLCDA++ LIIFS+ GKL ++C+    M + +E+  K       T  +  E +  +   NE   L+     LQ + R   GEDL S+   +L+ LE +L+SS+  VR  + + L  QL  L+RKE+M+ E N  + R ++E
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTQ-SMTKTLEKYQKCSYAGPETAVQNRESEQLKASRNEYLKLKARVENLQRTQRNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEE 176          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AG_TOBAC (Floral homeotic protein AGAMOUS OS=Nicotiana tabacum GN=AG1 PE=2 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 6.873e-30
Identity = 90/243 (37.04%), Postives = 127/243 (52.26%), Query Frame = 3
Query:   48 RIMGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKV----TGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQE-HRAALEYQQAAMEAKPAEEHHHQVLDHFPFLGDQQPSSVLQLATNSIPHQIHPYHHLQLAQPNLQ 761
            R +GRGKI IKRIEN T RQVTF KRR GLLKK +ELSVLCDA++ LI+FSS G+L +Y      ++  IER  K     + T      + +    E + LR +   LQ   R   GE L ++   DL  LE ++E  ++K+R +KNELL  +++ ++++E  L   N  +   I E  RA  + QQ  M   P    +  V     F   +    V  L TN+        H+ +  QP+LQ
Sbjct:   15 RKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN--SVKATIERYKKACSDSSNTGSISEANAQYYQQEASKLRAQIGNLQNQNRNMLGESLAALSLRDLKNLEQKIEKGISKIRSKKNELLFAEIEYMQKREIDLHNNNQYLRAKIAETERAQQQQQQQQMNLMPGSSSYELVPPPHQF-DTRNYLQVNGLQTNN--------HYTRQDQPSLQ 246          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD27_ORYSJ (MADS-box transcription factor 27 OS=Oryza sativa subsp. japonica GN=MADS27 PE=2 SV=2)

HSP 1 Score: 131.339 bits (329), Expect = 8.977e-30
Identity = 80/223 (35.87%), Postives = 130/223 (58.30%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIER--RLKVTGTRIPEHDSREQIF-NELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAA-LEYQQAAMEAKPAEEHHHQVLDHFPFLGDQQPSSVLQLATNSIP 710
            MGRGKI I+RI+N T+RQVTFSKRR G+ KK  EL++LCDA++GL+IFSSTG+L +Y +    M+ +I+R  + K     +   +S  + +  E A LR++   LQ + R+  GEDL  +   +L  LE++LE S+  VR +K+ +L  ++  L RK  ++ +EN  +Y+ I   R    E  +   E +   E +      + F   ++ +  +QL  +++P
Sbjct:    1 MGRGKIVIRRIDNSTSRQVTFSKRRNGIFKKAKELAILCDAEVGLMIFSSTGRLYEYSST--SMKSVIDRYGKSKDEQQAVANPNSELKFWQREAASLRQQLHNLQENHRQLMGEDLSGLNVKELQSLENQLEISLRSVRTKKDHVLIDEIHELNRKGSLVHQENMELYKKISLIRQENAELYKKIYETEGPSEVNRDSPTPYNFAVIEKTNVPVQLGLSTLP 221          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AGL9_PETHY (Agamous-like MADS-box protein AGL9 homolog OS=Petunia hybrida GN=FBP2 PE=1 SV=2)

HSP 1 Score: 130.954 bits (328), Expect = 1.172e-29
Identity = 78/190 (41.05%), Postives = 113/190 (59.47%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLK----VTGTRIPEHDSRE-QIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAA-LEYQQAAME 605
            MGRG++ +KRIEN   RQVTF+KRR GLLKK +ELSVLCDA++ LIIFS+ GKL ++C+    M + +ER  K       T I   ++ E     E   L+     LQ S R   GEDLG +   +L+ LE +L+ S+ ++R  + +L+  QL +L+RKE  L E N  + + + E     L++QQ A +
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSS-SMLKTLERYQKCNYGAPETNISTREALEISSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLQDLQRKEHALNEANRTLKQRLMEGSTLNLQWQQNAQD 189          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AG_BRANA (Floral homeotic protein AGAMOUS OS=Brassica napus GN=AG1 PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.531e-29
Identity = 82/207 (39.61%), Postives = 118/207 (57.00%), Query Frame = 3
Query:   33 EQEKIRIMGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKV----TGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAMEAKPAEEHHHQVL 641
            E    R  GRGKI IKRIEN T RQVTF KRR GLLKK +ELSVLCDA++ LI+FSS G+L +Y      ++  IER  K     + T      + +    E A LR++   +Q S R+  GE +GS+   +L  LE  L+ SVN++R +KNELL  ++D ++++E  L  +N  +   I E+    E    +M   P   ++ Q++
Sbjct:   10 ESSPQRKAGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN--SVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISIQNSNRQLMGETIGSMSPKELRNLEGRLDRSVNRIRSKKNELLFAEIDYMQKREVDLHNDNQLLRAKIAEN----ERNNPSMSLMPGGSNYEQIM 210          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AGL9_ARADE (Agamous-like MADS-box protein AGL9 homolog OS=Aranda deborah PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.531e-29
Identity = 77/207 (37.20%), Postives = 119/207 (57.49%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETR--RLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQ-------QAAMEAKPAEEHHHQVLDH 647
            MGRG++ +K IEN   RQVTF+KRR  LLKK +ELSVLCDA++ LIIFS+ GKL ++C+    ++ + + +    G+      SRE   ++   L+ + R   LQ S R   GEDLG +   +L+QLE +L+SS+ ++R  + + +  QL +L+R+E+ML E N  + R  +E   A + Q        A    +   +HH +   H
Sbjct:    1 MGRGRVELKMIENKINRQVTFAKRRKRLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSTSMLKTLEKYQKCNFGSPESTIISRETQSSQQEYLKLKNRVEALQRSQRNLLGEDLGPLGSKELEQLERQLDSSLRQIRSTRTQFMLDQLADLQRREQMLCEANKTLKRRFEESSQANQQQVWDPSNTHAVGYGRQPAQHHGEAFYH 207          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MADS2_ORYSJ (MADS-box transcription factor 2 OS=Oryza sativa subsp. japonica GN=MADS2 PE=2 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 2.000e-29
Identity = 72/184 (39.13%), Postives = 110/184 (59.78%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAME 605
            MGRGKI IKRIEN T RQVTFSKRR+G+LKK  E+SVLCDA++G++IFSS GKL  YC+    + +I+E+    +G +I   +  + +  E+  ++KE   +Q+ +R   GEDL S+   +L  +E  L++ +  V D+    L    +   R ++MLE+EN  +   + +   AL      +E
Sbjct:    1 MGRGKIEIKRIENSTNRQVTFSKRRSGILKKAREISVLCDAEVGVVIFSSAGKLYDYCSPKTSLSRILEKYQTNSG-KILWDEKHKSLSAEIDRIKKENDNMQIELRHLKGEDLNSLQPKELIMIEEALDNGIVNVNDK----LMDHWERHVRTDKMLEDENKLLAFKLHQQDIALSGSMRDLE 179          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AGL5_ARATH (Agamous-like MADS-box protein AGL5 OS=Arabidopsis thaliana GN=AGL5 PE=2 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 2.000e-29
Identity = 78/193 (40.41%), Postives = 118/193 (61.14%), Query Frame = 3
Query:   39 EKIRIMGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPE---HDSREQIF-NELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMY-RWIQEHRAALEYQQAAM 602
            E  + +GRGKI IKRIEN T RQVTF KRR GLLKK +ELSVLCDA++ L+IFS+ G+L +Y     R    IER  K     +      ++  Q +  E + LR++ R +Q   R   GE LGS+ + +L  LE  LE  +++VR +K+E+L  +++ ++++E  +E +N NMY R     R  L+ Q++++
Sbjct:   11 ESSKKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYANNSVR--GTIERYKKACSDAVNPPTITEANTQYYQQEASKLRRQIRDIQNLNRHILGESLGSLNFKELKNLESRLEKGISRVRSKKHEMLVAEIEYMQKRE--IELQNDNMYLRSKITERTGLQQQESSV 199          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD56_ORYSJ (MADS-box transcription factor 56 OS=Oryza sativa subsp. japonica GN=MADS56 PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 2.612e-29
Identity = 72/168 (42.86%), Postives = 107/168 (63.69%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPE---HDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNM 548
            M RG+  +KRIENPT+RQVTFSKRR GLLKK  ELSVLCDA++ LI+FS  G+L ++ + P  +++ I+R    T   +         +Q+ ++   L K+   L  S R+  GE+L     ++L  LE +LE S++K+R +K ELL+QQ+  L+ KER L ++N N+
Sbjct:    1 MVRGRTELKRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGRLYEFASAP-SLQKTIDRYKAYTKDHVNNKTIQQDIQQVKDDTLGLAKKLEALDESRRKILGENLEGFSIEELRGLEMKLEKSLHKIRLKKTELLEQQIAKLKEKERTLLKDNENL 167          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: FBP1_PETHY (Floral homeotic protein FBP1 OS=Petunia hybrida GN=FBP1 PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 2.612e-29
Identity = 73/208 (35.10%), Postives = 126/208 (60.58%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQE-HRAALEYQQAAMEAKPAEEHHHQVLDHFPFLGDQQP 674
            MGRGKI IKRIEN + RQVT+SKRR G+LKK  E+SVLCDA++ +IIF+S+GK+ ++ +    +  I+++  K+TG R+ +    E + NE+  ++K+   +Q+ +R   GED+ S+ + +L  LE  LE+ +  +R+++NE+L+     +R+K + +EEE   +   +++   A +      +     +  +H   +H PF    QP
Sbjct:    1 MGRGKIEIKRIENSSNRQVTYSKRRNGILKKAKEISVLCDARVSVIIFASSGKMHEFSST--SLVDILDQYHKLTGRRLLD-AKHENLDNEINKVKKDNDNMQIELRHLKGEDITSLNHRELMILEDALENGLTSIRNKQNEVLRM----MRKKTQSMEEEQDQLNCQLRQLEIATMNRNMGEIGEVFQQRENHDYQNHMPFAFRVQP 201          
The following BLAST results are available for this feature:
BLAST of DC900364 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
MADS7_ORYSI6.873e-3042.37MADS-box transcription factor 7 OS=Oryza sativa su... [more]
AG_TOBAC6.873e-3037.04Floral homeotic protein AGAMOUS OS=Nicotiana tabac... [more]
MAD27_ORYSJ8.977e-3035.87MADS-box transcription factor 27 OS=Oryza sativa s... [more]
AGL9_PETHY1.172e-2941.05Agamous-like MADS-box protein AGL9 homolog OS=Petu... [more]
AG_BRANA1.531e-2939.61Floral homeotic protein AGAMOUS OS=Brassica napus ... [more]
AGL9_ARADE1.531e-2937.20Agamous-like MADS-box protein AGL9 homolog OS=Aran... [more]
MADS2_ORYSJ2.000e-2939.13MADS-box transcription factor 2 OS=Oryza sativa su... [more]
AGL5_ARATH2.000e-2940.41Agamous-like MADS-box protein AGL5 OS=Arabidopsis ... [more]
MAD56_ORYSJ2.612e-2942.86MADS-box transcription factor 56 OS=Oryza sativa s... [more]
FBP1_PETHY2.612e-2935.10Floral homeotic protein FBP1 OS=Petunia hybrida GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900364 VSS Citrus sinensis cDNA clone VS28932 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900364 ID=DC900364|Name=DC900364|organism=Citrus sinensis|type=EST|length=1050bp
CGGCACGAGTTACAAGCAAAGCAAGAGAAAGCGAACAAGAAAAGATCAGA
ATAATGGGACGTGGGAAGATAGCGATCAAGAGGATTGAGAACCCGACGAC
GAGGCAAGTAACCTTCTCGAAACGGAGAGCTGGGCTTTTGAAGAAGACCC
ATGAACTCTCAGTGCTTTGTGATGCTCAAATTGGCCTCATCATCTTCTCA
AGTACCGGAAAATTGTGCCAGTACTGCACTGAGCCTTTCAGAATGGAGCA
AATCATTGAGAGGCGCCTCAAAGTTACAGGGACTCGCATCCCTGAGCATG
ATAGCCGGGAACAAATATTCAATGAGTTGGCGGTTCTGAGAAAAGAAACC
CGCCGCCTTCAGCTGAGTATGCGACGCTACACTGGTGAGGACTTGGGTTC
TATACCTTATGATGATCTCGATCAACTTGAACATGAGCTTGAAAGCTCTG
TTAACAAGGTCCGAGATCGCAAGAATGAGCTTCTTCAACAACAGCTGGAT
AATCTTCGTAGGAAGGAGCGAATGCTGGAGGAAGAGAACAGCAACATGTA
CCGTTGGATTCAGGAGCATAGGGCAGCATTGGAGTATCAGCAAGCTGCAA
TGGAAGCAAAGCCAGCTGAGGAGCATCATCATCAAGTCTTGGATCATTTT
CCATTCTTGGGAGATCAACAACCCAGTAGTGTGCTTCAGCTTGCAACCAA
CAGTATCCCTCATCAAATTCACCCTTATCACCATCTTCAGCTTGCTCAGC
CCAACCTTCAGGATCCCAATGTCTAGTATCAGCTTAAGAAGGATGTCCGA
AAGAGGTTGCGAAAGAGTAGATGATATAATCATTATGAAGATGACTCATA
ATTATCTCCTGGTTATTAATTACCTTATATAGTTTGCAGTAATTAAATTA
TTATTTTATGTTTTAGAAGCTACGAATGATCTGCTCGCTATGTGTGTTCC
TCATATTTATAACTCTTTGTATATGTATTGAGATATGTGACTTCAAACAA
TTGTACTGTGGTATGTTTTAGACATGAAAAAGTACTTGAATTTCTGCCGT
back to top