DC900364

Overview
NameDC900364
Unique NameDC900364
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1050
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MADS4_ORYSJ (MADS-box transcription factor 4 OS=Oryza sativa subsp. japonica GN=MADS4 PE=1 SV=3)

HSP 1 Score: 124.405 bits (311), Expect = 1.097e-27
Identity = 80/216 (37.04%), Postives = 119/216 (55.09%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFR-----MEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAMEAKPAEEHHHQVLD---HFPFLGDQQPS 677
            MGRGKI IKRIEN T RQVTFSKRRAG+LKK  E+ VLCDA++G++IFSS GKL  YCT         + +I+E+    +G +I   +  + +  E+  ++KE   +Q+ +R   GEDL S+   +L  +E  L +    +RD+  +  +      +R E+MLE+E+  +    + H+  +E      E +    +HH   D     PF    QPS
Sbjct:    1 MGRGKIEIKRIENSTNRQVTFSKRRAGILKKAREIGVLCDAEVGVVIFSSAGKLSDYCTPKTTSVFPPLSRILEKYQTNSG-KILWDEKHKSLSAEIDRVKKENDNMQIELRHMKGEDLNSLQPKELIAIEEALNNGQANLRDKMMDHWRMH----KRNEKMLEDEHKMLA--FRVHQQEVELSGGIRELELG--YHHDDRDFAASMPFTFRVQPS 207          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AGL6_ARATH (Agamous-like MADS-box protein AGL6 OS=Arabidopsis thaliana GN=AGL6 PE=1 SV=2)

HSP 1 Score: 124.405 bits (311), Expect = 1.097e-27
Identity = 68/168 (40.48%), Postives = 105/168 (62.50%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEH---DSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNM 548
            MGRG++ +KRIEN   RQVTFSKRR GLLKK +ELSVLCDA++ LIIFSS GKL ++ +    +E  IER  +     +  +   ++ +    E+  L+ +   L  + R   GEDLG +   +L  LE +LE+++   R RK +++ +++++LR+KER L + N  +
Sbjct:    1 MGRGRVEMKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGS--VGIESTIERYNRCYNCSLSNNKPEETTQSWCQEVTKLKSKYESLVRTNRNLLGEDLGEMGVKELQALERQLEAALTATRQRKTQVMMEEMEDLRKKERQLGDINKQL 166          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: SEP2_ARATH (Developmental protein SEPALLATA 2 OS=Arabidopsis thaliana GN=SEP2 PE=1 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.433e-27
Identity = 70/166 (42.17%), Postives = 102/166 (61.45%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHD----SREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEEN 539
            MGRG++ +KRIEN   RQVTF+KRR GLLKK +ELSVLCDA++ LI+FS+ GKL ++C+    M + +ER  K +   I  ++      E  + E   L+     LQ   R   GEDLG +   +L+QLE +L+ S+ +VR  K + +  QL +L+ KE +L + N
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCSTS-NMLKTLERYQKCSYGSIEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLDAN 165          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD25_ORYSJ (MADS-box transcription factor 25 OS=Oryza sativa subsp. japonica GN=MADS25 PE=2 SV=2)

HSP 1 Score: 124.02 bits (310), Expect = 1.433e-27
Identity = 67/168 (39.88%), Postives = 109/168 (64.88%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKV--TGTRIPEHDSREQIF-NELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNM 548
            MGRGKIAIKRI+N   RQVTFSKRR GL+KK  EL++LCDA +GLI+FS TG+L  + +    M+ IIER  +      R+    S  + +  E+  LR++ + L  + R+  GE++ +    DL  L++++E S++ +R++K++LL +++  L  K  ++++ENS +
Sbjct:    1 MGRGKIAIKRIDNTMNRQVTFSKRRGGLMKKARELAILCDADVGLIVFSCTGRLYDFSSS--SMKSIIERYQEAGEEHCRLLNPMSEAKFWQREVTTLRQQVQNLHHNNRQLLGEEISNFTVRDLQLLQNQVEMSLHSIRNKKDQLLAEEILKLNEKGSLVQKENSEL 166          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD16_ORYSJ (MADS-box transcription factor 16 OS=Oryza sativa subsp. japonica GN=MADS16 PE=1 SV=2)

HSP 1 Score: 124.02 bits (310), Expect = 1.433e-27
Identity = 64/154 (41.56%), Postives = 100/154 (64.94%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRK 515
            MGRGKI IKRIEN T RQVT+SKRR G++KK  EL+VLCDAQ+ +I+FSSTGK  ++C+    ++ I +R  +  GT +   +  E +   L+ L+   R L+  +R+  GEDL  + +D+L  LE  +++++ +VR RK  ++  Q +  ++K
Sbjct:    1 MGRGKIEIKRIENATNRQVTYSKRRTGIMKKARELTVLCDAQVAIIMFSSTGKYHEFCSPSTDIKGIFDRYQQAIGTSL-WIEQYENMQRTLSHLKDINRNLRTEIRQRMGEDLDGLEFDELRGLEQNVDAALKEVRHRKYHVITTQTETYKKK 153          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AGL13_ARATH (Agamous-like MADS-box protein AGL13 OS=Arabidopsis thaliana GN=AGL13 PE=2 SV=2)

HSP 1 Score: 123.635 bits (309), Expect = 1.872e-27
Identity = 70/175 (40.00%), Postives = 110/175 (62.86%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQ---IFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEH 569
            MGRGK+ +KRIEN  TRQVTFSKR++GLLKK +ELSVLCDA++ LIIFS+ GKL ++      + + IER  +     + ++D+ E    +  E+  L+ +   L  + R   GEDL  +   +L  LE +LE +++  R +K +++ +Q++ LRRKER L + N+ +    ++H
Sbjct:    1 MGRGKVEVKRIENKITRQVTFSKRKSGLLKKAYELSVLCDAEVSLIIFSTGGKLYEFSN--VGVGRTIERYYRCKDNLL-DNDTLEDTQGLRQEVTKLKCKYESLLRTHRNLVGEDLEGMSIKELQTLERQLEGALSATRKQKTQVMMEQMEELRRKERELGDINNKLKLETEDH 172          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AG_SOLLC (Floral homeotic protein AGAMOUS OS=Solanum lycopersicum GN=AG1 PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 2.445e-27
Identity = 75/202 (37.13%), Postives = 111/202 (54.95%), Query Frame = 3
Query:   48 RIMGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKV----TGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQE-HRAALEYQQAAMEAKPAEEHHHQV 638
            R +GRGKI IKRIEN T RQVTF KRR GLLKK +ELSVLCDA++ L++FS+ G+L +Y      ++  IER  K     + T      + +    E + LR +   L    R   GE L  +   +L  LE  +E  ++K+R +KNELL  +++ ++++E  L   N  +   I E  RA  ++QQ  +    +  +H  V
Sbjct:   15 RKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSNRGRLYEYANN--SVKATIERYKKACSDSSNTGSVSEANAQYYQQEASKLRAQIGNLMNQNRNMMGEALAGMKLKELKNLEQRIEKGISKIRSKKNELLFAEIEYMQKREVDLHNNNQYLRAKIAETERAQHQHQQMNLMPGSSSNYHELV 214          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: DEFA_ANTMA (Floral homeotic protein DEFICIENS OS=Antirrhinum majus GN=DEFA PE=1 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 3.193e-27
Identity = 65/165 (39.39%), Postives = 102/165 (61.82%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNM 548
            M RGKI IKRIEN T RQVT+SKRR GL KK HELSVLCDA++ +I+ SST KL +Y +     +Q+ ++  K  G  +      E++   L  L +  R L+  +R+  GE L  + Y+ +  L  ++++S+  +R+RK +++  Q+D  ++K R +EE + N+
Sbjct:    1 MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIIMISSTQKLHEYISPTTATKQLFDQYQKAVGVDL-WSSHYEKMQEHLKKLNEVNRNLRREIRQRMGESLNDLGYEQIVNLIEDMDNSLKLIRERKYKVISNQIDTSKKKVRNVEEIHRNL 164          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD50_ORYSJ (MADS-box transcription factor 50 OS=Oryza sativa subsp. japonica GN=MADS50 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 7.113e-27
Identity = 73/169 (43.20%), Postives = 102/169 (60.36%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVT----GTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNM 548
            M RGK  +KRIENPT+RQVTFSKRR GLLKK  ELSVLCDA++ LI+FS  GKL ++ +     ++ IER    T    G +  + D  EQ+  +   L K+   L+   R+  GE L     ++L  LE +LE S+  +R RK +LL++Q+  LR KE  L ++N  +
Sbjct:    1 MVRGKTQMKRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFASA--STQKTIERYRTYTKENIGNKTVQQDI-EQVKADADGLAKKLEALETYKRKLLGEKLDECSIEELHSLEVKLERSLISIRGRKTKLLEEQVAKLREKEMKLRKDNEEL 166          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD33_ORYSJ (MADS-box transcription factor 33 OS=Oryza sativa subsp. japonica GN=MADS33 PE=2 SV=2)

HSP 1 Score: 121.709 bits (304), Expect = 7.113e-27
Identity = 74/176 (42.05%), Postives = 107/176 (60.80%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIER-RLKVTGTRI-PEHDSREQIFNE-LAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHR 572
            M RGK+ ++RIENP  RQVTF KRR GLLKK  ELSVLCDA +G+IIFSS GKL +  T    M  ++ER +  V G ++ P    R+Q+  + + +LR+E   LQ  +R   G   G +  D L  LE  LE  + ++R  K +++QQ++  LR KE +L+E N  +   ++E +
Sbjct:    1 MVRGKVQMRRIENPVHRQVTFCKRRGGLLKKARELSVLCDADVGVIIFSSQGKLHELATNG-NMHNLVERYQSNVAGGQMEPGALQRQQVAEQGIFLLREEIDLLQRGLRSTYGGGAGEMTLDKLHALEKGLELWIYQIRTTKMQMMQQEIQFLRNKEGILKEANEMLQEKVKEQQ 175          
The following BLAST results are available for this feature:
BLAST of DC900364 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
MADS4_ORYSJ1.097e-2737.04MADS-box transcription factor 4 OS=Oryza sativa su... [more]
AGL6_ARATH1.097e-2740.48Agamous-like MADS-box protein AGL6 OS=Arabidopsis ... [more]
SEP2_ARATH1.433e-2742.17Developmental protein SEPALLATA 2 OS=Arabidopsis t... [more]
MAD25_ORYSJ1.433e-2739.88MADS-box transcription factor 25 OS=Oryza sativa s... [more]
MAD16_ORYSJ1.433e-2741.56MADS-box transcription factor 16 OS=Oryza sativa s... [more]
AGL13_ARATH1.872e-2740.00Agamous-like MADS-box protein AGL13 OS=Arabidopsis... [more]
AG_SOLLC2.445e-2737.13Floral homeotic protein AGAMOUS OS=Solanum lycoper... [more]
DEFA_ANTMA3.193e-2739.39Floral homeotic protein DEFICIENS OS=Antirrhinum m... [more]
MAD50_ORYSJ7.113e-2743.20MADS-box transcription factor 50 OS=Oryza sativa s... [more]
MAD33_ORYSJ7.113e-2742.05MADS-box transcription factor 33 OS=Oryza sativa s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900364 VSS Citrus sinensis cDNA clone VS28932 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900364 ID=DC900364|Name=DC900364|organism=Citrus sinensis|type=EST|length=1050bp
CGGCACGAGTTACAAGCAAAGCAAGAGAAAGCGAACAAGAAAAGATCAGA
ATAATGGGACGTGGGAAGATAGCGATCAAGAGGATTGAGAACCCGACGAC
GAGGCAAGTAACCTTCTCGAAACGGAGAGCTGGGCTTTTGAAGAAGACCC
ATGAACTCTCAGTGCTTTGTGATGCTCAAATTGGCCTCATCATCTTCTCA
AGTACCGGAAAATTGTGCCAGTACTGCACTGAGCCTTTCAGAATGGAGCA
AATCATTGAGAGGCGCCTCAAAGTTACAGGGACTCGCATCCCTGAGCATG
ATAGCCGGGAACAAATATTCAATGAGTTGGCGGTTCTGAGAAAAGAAACC
CGCCGCCTTCAGCTGAGTATGCGACGCTACACTGGTGAGGACTTGGGTTC
TATACCTTATGATGATCTCGATCAACTTGAACATGAGCTTGAAAGCTCTG
TTAACAAGGTCCGAGATCGCAAGAATGAGCTTCTTCAACAACAGCTGGAT
AATCTTCGTAGGAAGGAGCGAATGCTGGAGGAAGAGAACAGCAACATGTA
CCGTTGGATTCAGGAGCATAGGGCAGCATTGGAGTATCAGCAAGCTGCAA
TGGAAGCAAAGCCAGCTGAGGAGCATCATCATCAAGTCTTGGATCATTTT
CCATTCTTGGGAGATCAACAACCCAGTAGTGTGCTTCAGCTTGCAACCAA
CAGTATCCCTCATCAAATTCACCCTTATCACCATCTTCAGCTTGCTCAGC
CCAACCTTCAGGATCCCAATGTCTAGTATCAGCTTAAGAAGGATGTCCGA
AAGAGGTTGCGAAAGAGTAGATGATATAATCATTATGAAGATGACTCATA
ATTATCTCCTGGTTATTAATTACCTTATATAGTTTGCAGTAATTAAATTA
TTATTTTATGTTTTAGAAGCTACGAATGATCTGCTCGCTATGTGTGTTCC
TCATATTTATAACTCTTTGTATATGTATTGAGATATGTGACTTCAAACAA
TTGTACTGTGGTATGTTTTAGACATGAAAAAGTACTTGAATTTCTGCCGT
back to top