DC900363

Overview
NameDC900363
Unique NameDC900363
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1374
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900363_ssr1068 microsatellite DC900363_ssr1068:1068..1083. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7102 contig Csv1_Contig7102:114..1481. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI4_ORYSJ (Chitinase 4 OS=Oryza sativa subsp. japonica GN=Cht4 PE=2 SV=2)

HSP 1 Score: 101.679 bits (252), Expect = 1.097e-20
Identity = 65/207 (31.40%), Postives = 94/207 (45.41%), Query Frame = 1
Query:  319 FWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMS-PSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGV 936
            F+  QSF+ A   Y   GF    T  D  +EI AF AHV  +T               +CY +E++  +  YCD S K  +PC PG +YYGRG + I WN+NYG  G+ +  D L  P+ + Q+ T++F+ A+W WM                      N+        FG T+  + G   C   +  A+N  V++Y  Y    GV
Sbjct:  109 FYTRQSFLNAARSYS--GFANDRTNDDSKREIAAFFAHVTHETG-------------HMCYINEINGANMDYCDKSNKQ-WPCQPGKKYYGRGPLQISWNFNYGPAGKNIGFDGLRDPDKVAQDPTISFKTALWFWM----------------------NNVHQVMSQGFGATIRAINGALECNGKNPGAVNARVNYYKDYCRQFGV 277          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI4_BRANA (Basic endochitinase CHB4 OS=Brassica napus PE=1 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 9.286e-20
Identity = 71/220 (32.27%), Postives = 98/220 (44.55%), Query Frame = 1
Query:  319 FWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMS-PSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSC 975
            F+   SFI A   +    F  + T+    +EI    AH   +T                CY  E++  S+ YCD++ +  YPC PG  Y+GRG I + WNYNYGA G++L  +LL  PE +  N T+AF   +W WM  V               +P  N         FG T+  + G   C  G+  A+N  + +Y  Y   LGV     GPN  LSC
Sbjct:   97 FYTRDSFINAANTFP--NFANSVTR----REIATMFAHFTHETG-------------HFCYIEEINGASRDYCDENNRQ-YPCAPGKGYFGRGPIQLSWNYNYGACGQSLNLNLLGQPELVSSNPTVAFRTGLWFWMNSV---------------RPVLNQ-------GFGATIRAINGME-CNGGNSGAVNARIRYYRDYCGQLGV---DPGPN--LSC 268          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHIP_BETVU (Acidic endochitinase SP2 OS=Beta vulgaris GN=SP2 PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 3.529e-19
Identity = 60/203 (29.56%), Postives = 84/203 (41.38%), Query Frame = 1
Query:  373 FGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPS--QSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSC 975
            FG  G+  D  +EI AF AH+  +T+              LC+  E       +YCD      YPC  G +YYGRG + + WNYNY   G+A+  D L +PE +  +   +F+AA+W WMT V                       S     FG T   + G   C   + D  N+ +  Y  Y    GV      P + L+C
Sbjct:  126 FGNEGSSDDNKREIAAFFAHISHETT-------------NLCHIEERDGDVGDAYCDQDKAAQYPCAAGKKYYGRGPLQLSWNYNYALAGQAIGFDGLGNPEKVATDVNTSFKAAMWFWMTNVH----------------------SVMNQGFGATTKAINGALECNGQNQDQANDRIQFYKKYCADFGV-----APGDNLTC 288          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHIT_DIOJA (Acidic endochitinase OS=Dioscorea japonica PE=1 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 1.483e-17
Identity = 67/220 (30.45%), Postives = 96/220 (43.64%), Query Frame = 1
Query:  319 FWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSP-SQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSC 975
            F+   +F+ A   Y   GFGT  T  D+ +EI A+ AHV  +T               LCY  E    + +YC +S +Y  PC P  EY+GRG + + WNYNY   G+ L  D LN P+ + ++  ++F+ ++W W+   K  Q    D   G                FG T+ I+ G   C   +   M   V +Y  Y   LGV      P   L C
Sbjct:   71 FYTRSNFLEAVSAYP--GFGTKCTDEDRKREIAAYFAHVTHETG-------------HLCYIEERDGHANNYCQESQQY--PCNPNKEYFGRGPMQLSWNYNYIDAGKELHFDGLNDPDIVGRDPIISFKTSLWFWIR--KGVQYVILDPNQG----------------FGATIRIINGGQECDGHNTAQMMARVGYYQEYCAQLGV-----SPGNNLPC 250          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI4_PHAVU (Endochitinase PR4 OS=Phaseolus vulgaris GN=CHI4 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 2.141e-16
Identity = 59/207 (28.50%), Postives = 87/207 (42.03%), Query Frame = 1
Query:  319 FWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMS-PSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGV 936
            F+   +F++A   Y    FG  G++ D  +EI A  AH   +T                CY  E+   S+ YCD+     YPC+    Y+GRG I + WN+NYG  G A   D L  PE +  +  ++F+ A+W WM  V               +P  N         FG T+  + G   C   +   +   V++Y  Y   LGV
Sbjct:   93 FYTRDAFLSALNSYTD--FGRVGSEDDSKREIAAAFAHFTHETG-------------HFCYIEEIDGASKDYCDEESIAQYPCSSSKGYHGRGPIQLSWNFNYGPAGSANNFDGLGAPETVSNDVVVSFKTALWYWMQHV---------------RPVINQ-------GFGATIRAINGALECDGANPTTVQARVNYYTEYCRQLGV 262          
The following BLAST results are available for this feature:
BLAST of DC900363 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
CHI4_ORYSJ1.097e-2031.40Chitinase 4 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHI4_BRANA9.286e-2032.27Basic endochitinase CHB4 OS=Brassica napus PE=1 SV... [more]
CHIP_BETVU3.529e-1929.56Acidic endochitinase SP2 OS=Beta vulgaris GN=SP2 P... [more]
CHIT_DIOJA1.483e-1730.45Acidic endochitinase OS=Dioscorea japonica PE=1 SV... [more]
CHI4_PHAVU2.141e-1628.50Endochitinase PR4 OS=Phaseolus vulgaris GN=CHI4 PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900363 VSS Citrus sinensis cDNA clone VS28931 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900363 ID=DC900363|Name=DC900363|organism=Citrus sinensis|type=EST|length=1374bp
CTCATCTTCCCCCAAGTGAATCTCGAAACAACAGGTAGATCTGGTGAGAA
CGAGAAAATGAAGATGAAGAATGGCAGTGTGGCAATGACACTGACAGTGG
CACTAGTACTGGCACTGGCAGTGAGTTTGGCAAATGGAGATGAATCAGAG
AAGGTGATAGTGAAGAAGTTGAAGGGGAAAAAAGTTTGCATAAAAGGGTG
GGAGTGCCCAACATGGTCGAAATTCTGCTGTAACGAGACGATATCAGACT
ATTTCCAGGTTTACCAGTTTGAGAATTTCTTCTCGAAAAGGAACACGCCG
GTGGCACATGCCGTGGGATTCTGGGATTATCAGTCTTTCATTACTGCCAC
CGTCAAATATCAGCCCCTCGGCTTCGGTACCACCGGTACTAAGCTTGATA
AGATGAAGGAGATTTGCGCTTTTCTTGCCCACGTGGGCTGCAAGACCTCT
TGTGGATATGGAGTGGCCACTGGAGGACCATTGGCCTGGGGACTTTGCTA
CAACCATGAAATGAGCCCCAGTCAGTCATATTGTGATGATTCCTACAAAT
ACACATATCCCTGCACCCCTGGAGCTGAGTACTATGGCCGAGGTGCTATA
CCTATATACTGGAACTATAACTATGGAGCCACTGGGGAAGCATTGAAGGC
AGATCTGTTGAATCATCCCGAATACATTGAGCAGAATGCTACCCTTGCCT
TTGAGGCTGCAATTTGGAAGTGGATGACCCCAGTCAAGAAATCCCAGCCT
TCAGCCCATGATGCCTTTGTTGGCAACTGGAAGCCCACCAAGAATGATAC
TTTGTCCAAACGGGGACCTAACTTTGGTACCACAATGAATATCCTCTATG
GTGAGAGCGTATGCGGTCAGGGTGATATTGATGCTATGAACAACATTGTC
TCTCATTACTTGTATTACCTTGATCTGTTGGGTGTTGGCCGAGAGCAGGC
AGGACCTAATGAAGAACTCTCTTGTGCTGAGCAGAAAGCCTTCAACCCAA
ACACCGCACCTTCAGCTGCATCTTCTTGAGGACGTTTATTGTAGCCAAGC
TATTATTGTGGGAGTGACTCTCTCTCTCTCTCTAGGTGGGTACCATTACA
ATAAGACTGGGGTTAATTAAACTATTTGTTGTAAGTTTTTTTTTTTTTTT
CCATCTTTTCATATATTGCGCAAGGTCAATTAGTGTGTGGATTGGTCTGC
CCCTCTTCATTGCCGTTGTAGATTTGAGATTCATTTGGTTTGTAAAATCT
TCGTTATATCTGGTTACATATGTAATGATGAACCGCATGAACCACTCGTG
TGTTTCAATAGCAGAATTGTAAAGTATATGCTTATATTTTATTTATTCCG
GGATATCGACTCCTAGTTTCGTTT
back to top