DC900357

Overview
NameDC900357
Unique NameDC900357
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length547
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6192 contig Csv1_Contig6192:89..636. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT8_ARATH (Actin-8 OS=Arabidopsis thaliana GN=ACT8 PE=1 SV=2)

HSP 1 Score: 282.722 bits (722), Expect = 7.663e-76
Identity = 132/141 (93.62%), Postives = 138/141 (97.87%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            MAD +DIQP+VCDNGTGMVKAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKDAYVGDEAQSKRGILTLKYPIEHG+VSNWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAV
Sbjct:    1 MADADDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSKRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAV 141          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT6_SOLTU (Actin-71 OS=Solanum tuberosum GN=AC71 PE=3 SV=2)

HSP 1 Score: 282.337 bits (721), Expect = 1.001e-75
Identity = 136/141 (96.45%), Postives = 137/141 (97.16%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            MAD EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYV DEAQSKRGILTLKYP EHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV
Sbjct:    1 MADVEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHAGVMVGMGQKDAYVVDEAQSKRGILTLKYPXEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 141          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT7_ORYSJ (Actin-7 OS=Oryza sativa subsp. japonica GN=ACT7 PE=3 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 1.307e-75
Identity = 133/137 (97.08%), Postives = 136/137 (99.27%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            EDIQP+VCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAP+NPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    4 EDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKANREKMTQIMFETFNCPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT7_ORYSI (Actin-7 OS=Oryza sativa subsp. indica GN=ACT7 PE=3 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 1.307e-75
Identity = 133/137 (97.08%), Postives = 136/137 (99.27%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            EDIQP+VCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAP+NPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    4 EDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKANREKMTQIMFETFNCPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT2_ARATH (Actin-2 OS=Arabidopsis thaliana GN=ACT2 PE=1 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 2.230e-75
Identity = 131/141 (92.91%), Postives = 138/141 (97.87%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            MA+ +DIQP+VCDNGTGMVKAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKDAYVGDEAQSKRGILTLKYPIEHG+VSNWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAV
Sbjct:    1 MAEADDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSKRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAV 141          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT1_DAUCA (Actin-1 OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 8.473e-75
Identity = 134/141 (95.04%), Postives = 137/141 (97.16%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGI+TLKYPIEHGIVSNWDDM +IWHHTFYNELR +PEEHPVLLTEAPLNPKANREKMTQIM ETFN PAMYVAIQAV
Sbjct:    1 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGIITLKYPIEHGIVSNWDDM-RIWHHTFYNELRASPEEHPVLLTEAPLNPKANREKMTQIMIETFNVPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT_COLSC (Actin OS=Coleochaete scutata PE=2 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 1.107e-74
Identity = 132/141 (93.62%), Postives = 137/141 (97.16%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            MADGE++  LVCDNG+GMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF+ PAMYVAIQAV
Sbjct:    1 MADGEEVSALVCDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFSVPAMYVAIQAV 141          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT22_DICDI (Putative actin-22 OS=Dictyostelium discoideum GN=act22 PE=3 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 7.173e-74
Identity = 131/139 (94.24%), Postives = 135/139 (97.12%), Query Frame = 3
Query:   75 DGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            DGED+Q LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    2 DGEDVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT1_DICDI (Major actin OS=Dictyostelium discoideum GN=act1 PE=1 SV=2)

HSP 1 Score: 276.174 bits (705), Expect = 7.173e-74
Identity = 131/139 (94.24%), Postives = 135/139 (97.12%), Query Frame = 3
Query:   75 DGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            DGED+Q LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    2 DGEDVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT_SCHDU (Actin OS=Scherffelia dubia PE=2 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 9.368e-74
Identity = 132/142 (92.96%), Postives = 137/142 (96.48%), Query Frame = 3
Query:   69 MADGE-DIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            MADG+ ++  LVCDNG+GMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHG+VSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MADGDGEVSALVCDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV 142          
The following BLAST results are available for this feature:
BLAST of DC900357 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 444
Match NameE-valueIdentityDescription
ACT8_ARATH7.663e-7693.62Actin-8 OS=Arabidopsis thaliana GN=ACT8 PE=1 SV=2[more]
ACT6_SOLTU1.001e-7596.45Actin-71 OS=Solanum tuberosum GN=AC71 PE=3 SV=2[more]
ACT7_ORYSJ1.307e-7597.08Actin-7 OS=Oryza sativa subsp. japonica GN=ACT7 PE... [more]
ACT7_ORYSI1.307e-7597.08Actin-7 OS=Oryza sativa subsp. indica GN=ACT7 PE=3... [more]
ACT2_ARATH2.230e-7592.91Actin-2 OS=Arabidopsis thaliana GN=ACT2 PE=1 SV=1[more]
ACT1_DAUCA8.473e-7595.04Actin-1 OS=Daucus carota PE=2 SV=1[more]
ACT_COLSC1.107e-7493.62Actin OS=Coleochaete scutata PE=2 SV=1[more]
ACT22_DICDI7.173e-7494.24Putative actin-22 OS=Dictyostelium discoideum GN=a... [more]
ACT1_DICDI7.173e-7494.24Major actin OS=Dictyostelium discoideum GN=act1 PE... [more]
ACT_SCHDU9.368e-7492.96Actin OS=Scherffelia dubia PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900357 VSS Citrus sinensis cDNA clone VS28919 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900357 ID=DC900357|Name=DC900357|organism=Citrus sinensis|type=EST|length=547bp
CTCGTGCCGAATTCGGCACGAGGCGCCTCGTAATTCGCTCGTTCTCATCT
CATAACCGGTAGCAGAAGATGGCAGACGGTGAGGATATTCAGCCACTTGT
TTGTGATAATGGAACAGGAATGGTTAAGGCTGGGTTTGCCGGAGATGATG
CTCCACGGGCGGTGTTCCCCAGTATTGTTGGTCGTCCACGTCACACTGGT
GTGATGGTTGGCATGGGTCAGAAGGATGCGTATGTTGGTGATGAGGCTCA
ATCGAAGAGAGGTATTTTGACTTTGAAATACCCCATTGAGCATGGTATTG
TGAGCAACTGGGATGACATGGAGAAGATCTGGCATCACACCTTCTACAAT
GAGCTTCGTGTTGCCCCTGAAGAGCACCCTGTTCTTCTTACTGAGGCTCC
TCTCAATCCGAAGGCTAATCGCGAGAAGATGACCCAGATTATGTTTGAGA
CCTTTAATGCTCCCGCTATGTATGTTGCCATCCAGGCCGTCTTTCCTTGT
ATGCGAGTGGTCGTCCACTGGTATTGTGTGACTCTGTGATGGGTGAG
back to top