DC900357

Overview
NameDC900357
Unique NameDC900357
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length547
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6192 contig Csv1_Contig6192:89..636. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTC_RAT (Actin, alpha cardiac muscle 1 OS=Rattus norvegicus GN=Actc1 PE=1 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 3.936e-72
Identity = 127/141 (90.07%), Postives = 133/141 (94.33%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            M D E+   LVCDNG+G+VKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI++NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV 141          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTC_MOUSE (Actin, alpha cardiac muscle 1 OS=Mus musculus GN=Actc1 PE=1 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 3.936e-72
Identity = 127/141 (90.07%), Postives = 133/141 (94.33%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            M D E+   LVCDNG+G+VKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI++NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV 141          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTC_HUMAN (Actin, alpha cardiac muscle 1 OS=Homo sapiens GN=ACTC1 PE=1 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 3.936e-72
Identity = 127/141 (90.07%), Postives = 133/141 (94.33%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            M D E+   LVCDNG+G+VKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI++NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV 141          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTC_CHICK (Actin, alpha cardiac muscle 1 OS=Gallus gallus GN=ACTC1 PE=3 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 3.936e-72
Identity = 127/141 (90.07%), Postives = 133/141 (94.33%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            M D E+   LVCDNG+G+VKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI++NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV 141          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTC_BOVIN (Actin, alpha cardiac muscle 1 OS=Bos taurus GN=ACTC1 PE=2 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 3.936e-72
Identity = 127/141 (90.07%), Postives = 133/141 (94.33%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            M D E+   LVCDNG+G+VKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI++NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV 141          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT2_XENTR (Actin, alpha sarcomeric/cardiac OS=Xenopus tropicalis PE=2 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 3.936e-72
Identity = 127/141 (90.07%), Postives = 133/141 (94.33%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            M D E+   LVCDNG+G+VKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI++NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV 141          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT2_DAUCA (Actin-2 OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 5.140e-72
Identity = 134/138 (97.10%), Postives = 134/138 (97.10%), Query Frame = 3
Query:   69 MADG-EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIV-GRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYV 476
            MADG EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIV GRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKI HHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYV
Sbjct:    1 MADGGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKISHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYV 138          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTS_OREMO (Actin, alpha skeletal muscle OS=Oreochromis mossambicus GN=acta1 PE=2 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 8.768e-72
Identity = 126/141 (89.36%), Postives = 133/141 (94.33%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            M D ++   LVCDNG+G+VKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI++NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MCDDDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV 141          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTS_CYPCA (Actin, alpha skeletal muscle OS=Cyprinus carpio GN=acta1 PE=2 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 8.768e-72
Identity = 126/141 (89.36%), Postives = 133/141 (94.33%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            M D ++   LVCDNG+G+VKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI++NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MCDDDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV 141          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTSA_TAKRU (Actin, alpha skeletal muscle A OS=Takifugu rubripes GN=acta1a PE=2 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 8.768e-72
Identity = 126/141 (89.36%), Postives = 133/141 (94.33%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            M D ++   LVCDNG+G+VKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI++NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MCDDDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV 141          
The following BLAST results are available for this feature:
BLAST of DC900357 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 444
Match NameE-valueIdentityDescription
ACTC_RAT3.936e-7290.07Actin, alpha cardiac muscle 1 OS=Rattus norvegicus... [more]
ACTC_MOUSE3.936e-7290.07Actin, alpha cardiac muscle 1 OS=Mus musculus GN=A... [more]
ACTC_HUMAN3.936e-7290.07Actin, alpha cardiac muscle 1 OS=Homo sapiens GN=A... [more]
ACTC_CHICK3.936e-7290.07Actin, alpha cardiac muscle 1 OS=Gallus gallus GN=... [more]
ACTC_BOVIN3.936e-7290.07Actin, alpha cardiac muscle 1 OS=Bos taurus GN=ACT... [more]
ACT2_XENTR3.936e-7290.07Actin, alpha sarcomeric/cardiac OS=Xenopus tropica... [more]
ACT2_DAUCA5.140e-7297.10Actin-2 OS=Daucus carota PE=2 SV=1[more]
ACTS_OREMO8.768e-7289.36Actin, alpha skeletal muscle OS=Oreochromis mossam... [more]
ACTS_CYPCA8.768e-7289.36Actin, alpha skeletal muscle OS=Cyprinus carpio GN... [more]
ACTSA_TAKRU8.768e-7289.36Actin, alpha skeletal muscle A OS=Takifugu rubripe... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900357 VSS Citrus sinensis cDNA clone VS28919 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900357 ID=DC900357|Name=DC900357|organism=Citrus sinensis|type=EST|length=547bp
CTCGTGCCGAATTCGGCACGAGGCGCCTCGTAATTCGCTCGTTCTCATCT
CATAACCGGTAGCAGAAGATGGCAGACGGTGAGGATATTCAGCCACTTGT
TTGTGATAATGGAACAGGAATGGTTAAGGCTGGGTTTGCCGGAGATGATG
CTCCACGGGCGGTGTTCCCCAGTATTGTTGGTCGTCCACGTCACACTGGT
GTGATGGTTGGCATGGGTCAGAAGGATGCGTATGTTGGTGATGAGGCTCA
ATCGAAGAGAGGTATTTTGACTTTGAAATACCCCATTGAGCATGGTATTG
TGAGCAACTGGGATGACATGGAGAAGATCTGGCATCACACCTTCTACAAT
GAGCTTCGTGTTGCCCCTGAAGAGCACCCTGTTCTTCTTACTGAGGCTCC
TCTCAATCCGAAGGCTAATCGCGAGAAGATGACCCAGATTATGTTTGAGA
CCTTTAATGCTCCCGCTATGTATGTTGCCATCCAGGCCGTCTTTCCTTGT
ATGCGAGTGGTCGTCCACTGGTATTGTGTGACTCTGTGATGGGTGAG
back to top