DC900357

Overview
NameDC900357
Unique NameDC900357
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length547
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6192 contig Csv1_Contig6192:89..636. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ARP5_DICDI (Actin-related protein 5 OS=Dictyostelium discoideum GN=arpE PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.807e-12
Identity = 42/135 (31.11%), Postives = 76/135 (56.30%), Query Frame = 3
Query:   93 PLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHT-GVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVF 494
            P++ DNG+   +AGFA D +P+ +F S+VG+ + T   +VG   K+   GD ++     LT+K P +  ++ +    E I+ + F+        E+PVL+TE   NP   R+ M++++FE +N  ++   I ++F
Sbjct:   32 PIIIDNGSYQCRAGFANDISPKLIFRSLVGKVKSTSSPIVGNSLKE---GDISR-----LTIKSPFDSNLLVHPPSQESIFDYIFHKFGIENEIENPVLITEPTSNPTFCRKYMSELLFECYNIKSVVYGIDSLF 158          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ARP6_ARATH (Actin-related protein 6 OS=Arabidopsis thaliana GN=ARP6 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.739e-11
Identity = 39/128 (30.47%), Postives = 66/128 (51.56%), Query Frame = 3
Query:   96 LVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVA 479
            +V DNG G++KAG  G+  P  V P+ + +P  +   +        + DE         ++ PI+ G + N D   +IW H F + L +AP    +LLTEAPL+  + +    +++FE F   ++Y+A
Sbjct:    5 VVLDNGGGLIKAGQGGERDPTTVIPNCLYKPLSSKKFIHPSPLTT-LSDEIDLTSA--AVRRPIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQRTTDELVFEDFGFSSLYIA 129          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ARP6_NEUCR (Actin-like protein arp-6 OS=Neurospora crassa GN=arp-6 PE=3 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 5.060e-11
Identity = 43/146 (29.45%), Postives = 70/146 (47.95%), Query Frame = 3
Query:   96 LVCDNGTGMVKAGFAGDDA----PRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGI--LTLKYPIEHGIVSNWDDMEKIWHHTFYNE---LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVFPCMR 506
            LV DNG   +KAGF  DD     PR + P+ + R RH  +         YVG E +  +    L  + P+E G + NW+  ++IW   F+++    +  P +  ++LTE P +  + +    QI+FE +   + Y  +  VF   R
Sbjct:   22 LVLDNGADTIKAGFVSDDKSDGKPR-IIPNCLARDRHRKI---------YVGSELEKCKDFSELAFRRPVEKGFIVNWEAQKEIWDREFFDDKAAQKCDPSDTRLILTEQPNSLPSLQTHCDQIVFEEYGFASYYRGLGPVFNAYR 157          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: CT134_MOUSE (Putative uncharacterized actin family protein C20orf134 homolog OS=Mus musculus PE=3 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 8.631e-11
Identity = 27/71 (38.03%), Postives = 46/71 (64.79%), Query Frame = 3
Query:  279 YPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            +PI+HG+V +WD +E +W       L+V PE+ PVL++++P  P   REK+ +++FE    PA ++A  A+
Sbjct:   37 HPIKHGVVVDWDALEGLWERLMVGGLQVHPEQWPVLVSDSPSAPPKGREKVAELLFEALTVPACHMANTAL 107          
The following BLAST results are available for this feature:
BLAST of DC900357 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 444
Match NameE-valueIdentityDescription
ARP5_DICDI7.807e-1231.11Actin-related protein 5 OS=Dictyostelium discoideu... [more]
ARP6_ARATH1.739e-1130.47Actin-related protein 6 OS=Arabidopsis thaliana GN... [more]
ARP6_NEUCR5.060e-1129.45Actin-like protein arp-6 OS=Neurospora crassa GN=a... [more]
CT134_MOUSE8.631e-1138.03Putative uncharacterized actin family protein C20o... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900357 VSS Citrus sinensis cDNA clone VS28919 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900357 ID=DC900357|Name=DC900357|organism=Citrus sinensis|type=EST|length=547bp
CTCGTGCCGAATTCGGCACGAGGCGCCTCGTAATTCGCTCGTTCTCATCT
CATAACCGGTAGCAGAAGATGGCAGACGGTGAGGATATTCAGCCACTTGT
TTGTGATAATGGAACAGGAATGGTTAAGGCTGGGTTTGCCGGAGATGATG
CTCCACGGGCGGTGTTCCCCAGTATTGTTGGTCGTCCACGTCACACTGGT
GTGATGGTTGGCATGGGTCAGAAGGATGCGTATGTTGGTGATGAGGCTCA
ATCGAAGAGAGGTATTTTGACTTTGAAATACCCCATTGAGCATGGTATTG
TGAGCAACTGGGATGACATGGAGAAGATCTGGCATCACACCTTCTACAAT
GAGCTTCGTGTTGCCCCTGAAGAGCACCCTGTTCTTCTTACTGAGGCTCC
TCTCAATCCGAAGGCTAATCGCGAGAAGATGACCCAGATTATGTTTGAGA
CCTTTAATGCTCCCGCTATGTATGTTGCCATCCAGGCCGTCTTTCCTTGT
ATGCGAGTGGTCGTCCACTGGTATTGTGTGACTCTGTGATGGGTGAG
back to top