DC900357

Overview
NameDC900357
Unique NameDC900357
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length547
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6192 contig Csv1_Contig6192:89..636. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTC_BIOGL (Actin, cytoplasmic OS=Biomphalaria glabrata PE=2 SV=2)

HSP 1 Score: 266.929 bits (681), Expect = 4.351e-71
Identity = 127/137 (92.70%), Postives = 131/137 (95.62%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            ED+  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    4 EDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTC_BIOAL (Actin, cytoplasmic OS=Biomphalaria alexandrina PE=3 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 4.351e-71
Identity = 127/137 (92.70%), Postives = 131/137 (95.62%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            ED+  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    4 EDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTB_STRPU (Actin, cytoskeletal 1B OS=Strongylocentrotus purpuratus GN=CYIB PE=3 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 4.351e-71
Identity = 126/137 (91.97%), Postives = 133/137 (97.08%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            +D+  LV DNG+GMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYP+EHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAV
Sbjct:    4 DDVAALVIDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPMEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTA_STRPU (Actin, cytoskeletal 1A OS=Strongylocentrotus purpuratus GN=CYIA PE=3 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 4.351e-71
Identity = 126/137 (91.97%), Postives = 133/137 (97.08%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            +D+  LV DNG+GMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYP+EHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAV
Sbjct:    4 DDVAALVIDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPMEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTA_LIMPO (Actin, acrosomal process isoform OS=Limulus polyphemus PE=2 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 4.351e-71
Identity = 127/137 (92.70%), Postives = 131/137 (95.62%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            ED+  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    4 EDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT5_XENLA (Actin, cytoplasmic type 5 OS=Xenopus laevis PE=3 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 4.351e-71
Identity = 130/141 (92.20%), Postives = 134/141 (95.04%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            MAD E+I  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MAD-EEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT5_CHICK (Actin, cytoplasmic type 5 OS=Gallus gallus PE=3 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 4.351e-71
Identity = 130/141 (92.20%), Postives = 134/141 (95.04%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            MAD E+I  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MAD-EEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT1_SCHMA (Actin-1 OS=Schistosoma mansoni PE=2 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 4.351e-71
Identity = 127/137 (92.70%), Postives = 131/137 (95.62%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            ED+  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    4 EDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTM_MOLOC (Actin, larval muscle-type OS=Molgula oculata PE=3 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 5.683e-71
Identity = 124/140 (88.57%), Postives = 133/140 (95.00%), Query Frame = 3
Query:   72 ADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            ++ ED   +VCDNG+G+VKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI++NWDDMEKIWHHTFYNELR+APEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    3 SEEEDQTAIVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRIAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV 142          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT2_ECHGR (Actin-2 OS=Echinococcus granulosus GN=ACTII PE=3 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 5.683e-71
Identity = 130/141 (92.20%), Postives = 133/141 (94.33%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            MAD ED   LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MAD-EDTAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAV 140          
The following BLAST results are available for this feature:
BLAST of DC900357 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 444
Match NameE-valueIdentityDescription
ACTC_BIOGL4.351e-7192.70Actin, cytoplasmic OS=Biomphalaria glabrata PE=2 S... [more]
ACTC_BIOAL4.351e-7192.70Actin, cytoplasmic OS=Biomphalaria alexandrina PE=... [more]
ACTB_STRPU4.351e-7191.97Actin, cytoskeletal 1B OS=Strongylocentrotus purpu... [more]
ACTA_STRPU4.351e-7191.97Actin, cytoskeletal 1A OS=Strongylocentrotus purpu... [more]
ACTA_LIMPO4.351e-7192.70Actin, acrosomal process isoform OS=Limulus polyph... [more]
ACT5_XENLA4.351e-7192.20Actin, cytoplasmic type 5 OS=Xenopus laevis PE=3 S... [more]
ACT5_CHICK4.351e-7192.20Actin, cytoplasmic type 5 OS=Gallus gallus PE=3 SV... [more]
ACT1_SCHMA4.351e-7192.70Actin-1 OS=Schistosoma mansoni PE=2 SV=1[more]
ACTM_MOLOC5.683e-7188.57Actin, larval muscle-type OS=Molgula oculata PE=3 ... [more]
ACT2_ECHGR5.683e-7192.20Actin-2 OS=Echinococcus granulosus GN=ACTII PE=3 S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900357 VSS Citrus sinensis cDNA clone VS28919 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900357 ID=DC900357|Name=DC900357|organism=Citrus sinensis|type=EST|length=547bp
CTCGTGCCGAATTCGGCACGAGGCGCCTCGTAATTCGCTCGTTCTCATCT
CATAACCGGTAGCAGAAGATGGCAGACGGTGAGGATATTCAGCCACTTGT
TTGTGATAATGGAACAGGAATGGTTAAGGCTGGGTTTGCCGGAGATGATG
CTCCACGGGCGGTGTTCCCCAGTATTGTTGGTCGTCCACGTCACACTGGT
GTGATGGTTGGCATGGGTCAGAAGGATGCGTATGTTGGTGATGAGGCTCA
ATCGAAGAGAGGTATTTTGACTTTGAAATACCCCATTGAGCATGGTATTG
TGAGCAACTGGGATGACATGGAGAAGATCTGGCATCACACCTTCTACAAT
GAGCTTCGTGTTGCCCCTGAAGAGCACCCTGTTCTTCTTACTGAGGCTCC
TCTCAATCCGAAGGCTAATCGCGAGAAGATGACCCAGATTATGTTTGAGA
CCTTTAATGCTCCCGCTATGTATGTTGCCATCCAGGCCGTCTTTCCTTGT
ATGCGAGTGGTCGTCCACTGGTATTGTGTGACTCTGTGATGGGTGAG
back to top