DC900355

Overview
NameDC900355
Unique NameDC900355
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length455
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9788 contig Csv1_Contig9788:70..524. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS18_ENCCU (40S ribosomal protein S18 OS=Encephalitozoon cuniculi GN=RPS18 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.321e-20
Identity = 47/117 (40.17%), Postives = 73/117 (62.39%), Query Frame = 2
Query:   59 DFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLR 409
            + Q+I+R+ NTN+DG ++I FALT I+GIG R+A  +CK+  +D+ KRAGE+   E+  +   + +P    IP+ ++N Q+D  DG  S ++   LD  LR  +ER KK +  R  R
Sbjct:    9 EVQYIVRIHNTNIDGTKRIPFALTKIRGIGIRIATAICKRLGIDLRKRAGEMGEDEMKRISDAILDPASVGIPESYMNHQRDIIDGTTSHLIGTRLDADLRMMIERGKKNKRIRAYR 125          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_STAMF (30S ribosomal protein S13P OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / F1) GN=rps13p PE=3 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 2.253e-20
Identity = 43/119 (36.13%), Postives = 75/119 (63.03%), Query Frame = 2
Query:   59 DFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHS 415
            ++++I+R+  T++DG  K ++ L  IKG+G  LA  +C++  +D   R G L+  E+  +  +++NP  + IP W LNR+KDY  GK   ++   L   ++ D+ER KKI++ RG+RH+
Sbjct:    6 NYRYIVRIAGTDIDGSLKTVYGLAEIKGVGVNLAYGICRRLGIDPEMRIGYLTDEEIKRIEDLLSNPSAYDIPSWMLNRRKDYVTGKDMHLIGAELIFYVKQDIEREKKIKSWRGIRHA 124          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_THEVO (30S ribosomal protein S13P OS=Thermoplasma volcanium GN=rps13p PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.942e-20
Identity = 43/120 (35.83%), Postives = 82/120 (68.33%), Query Frame = 2
Query:   53 NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            N+DFQ+I+R+ N +++G++ I  AL+ +KGIG RL   + ++ ++   K+ GEL   E++ L   V N +++ +PDW LN +++   GK   +V+  LD+++++D+  +KKIR+++G+RH
Sbjct:   25 NKDFQYIVRIANKDLNGERPIPLALSDLKGIGLRLGYAIAERLNLQPTKKIGELKEDEIEKLKEYVEN-KEYDLPDWLLNHRREPVTGKNLNLVTTDLDVQVQEDINLMKKIRSYKGIRH 143          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_THEAC (30S ribosomal protein S13P OS=Thermoplasma acidophilum GN=rps13p PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.942e-20
Identity = 41/120 (34.17%), Postives = 84/120 (70.00%), Query Frame = 2
Query:   53 NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            N+DFQ+I+R+ N +++G++ +  AL+ +KGIG RL  ++ ++ D+ ++K+ GEL   +L+ L   V   +++ +P+W LN +++   GK   +VS  L++++++D+  +KKIR+++G+RH
Sbjct:   25 NKDFQYIVRIANKDLNGERLLPLALSDLKGIGERLGYVIAERLDLPIDKKIGELKEEQLEKLREYV-EAKEYDLPEWLLNHRREPVTGKNLNLVSTDLEIQVQEDINLMKKIRSYKGIRH 143          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_SULSO (30S ribosomal protein S13P OS=Sulfolobus solfataricus GN=rps13p PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.118e-19
Identity = 46/121 (38.02%), Postives = 76/121 (62.81%), Query Frame = 2
Query:   53 NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHS 415
            ++ F++++R+   +VDG  K+ +AL  +KGIG   A  + +K  +D N R GELS AE+  +  V+++     +P W  NR+KDY+ G    +V++ L   +R+D+ER KK R+ RG+RHS
Sbjct:    2 SQQFKYVVRIFGQDVDGTMKLPYALAMVKGIGYNTAKAIIRKLGMDPNARLGELSDAEVKKVESVISDHTIKGLPSWLYNRRKDYESGLDLHLVTSDLIFYVRNDIEREKKSRSWRGVRHS 122          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_UNCMA (30S ribosomal protein S13P OS=Uncultured methanogenic archaeon RC-I GN=rps13p PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.460e-19
Identity = 44/119 (36.97%), Postives = 77/119 (64.71%), Query Frame = 2
Query:   56 EDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            ++ ++I+R+ NT++DG Q + FALT IKGIG R++ I+ ++A VD +   G L   ++D L  V+ N  +  +P W LNR++D   G+   +    L M +++D+  +KKIR+++G+RH
Sbjct:   67 DEIKYIVRIANTDLDGTQTVEFALTGIKGIGNRISKIIARQAQVDPHATMGYLPPEQVDKLRAVIDN-LEANVPVWMLNRRRDIYTGEDKHLYGVDLTMAVKEDINIMKKIRSYKGIRH 184          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_NATPD (30S ribosomal protein S13P OS=Natronomonas pharaonis (strain DSM 2160 / ATCC 35678) GN=rps13p PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.490e-19
Identity = 45/120 (37.50%), Postives = 74/120 (61.67%), Query Frame = 2
Query:   53 NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            +ED Q+ +R+  T++DG + +  ALT + GIGRR+A I+ +KA+VD     G L   ++D+++  V      ++P+W  N QKD+  G+ +  + N L M  R D+ R+KKI  +RG+RH
Sbjct:   12 DEDLQYFVRIGQTDLDGTKSVERALTDMNGIGRRVARIIAEKAEVDRRDVLGALDEEKIDDVVAAVEEYGD-EVPEWLTNHQKDFFTGETTHEIGNDLQMSRRQDINRMKKIDAYRGVRH 130          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_METTP (30S ribosomal protein S13P OS=Methanosaeta thermophila (strain DSM 6194 / PT) GN=rps13p PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.490e-19
Identity = 47/118 (39.83%), Postives = 75/118 (63.56%), Query Frame = 2
Query:   59 DFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            + +HI+R+ NT++DGK+++  ALT IKG+GRRLA +   KA VD     G+L   +++ L  V+ + R   IP W +NR+KD   G    V+   +   LR+DL+ +KK R+++G+RH
Sbjct:   11 ELRHIVRIYNTDLDGKKQVQMALTGIKGVGRRLARVFAVKAGVDPCATLGKLPEEQIEALKNVIESVRD-NIPAWMMNRRKDIITGVDKHVMGAEVLTTLREDLDIMKKTRSYKGIRH 127          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_SULAC (30S ribosomal protein S13P OS=Sulfolobus acidocaldarius GN=rps13p PE=3 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 5.548e-19
Identity = 45/123 (36.59%), Postives = 79/123 (64.23%), Query Frame = 2
Query:   47 VANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHS 415
            ++ + F++I+R+   +VDG  K+ +AL  IKGIG   A I+ +K ++D +KR GE+S  ++  +  ++ N    + P+W  NRQKDY+ G    +V++ L   +R+D+ER ++ R+ RG+RHS
Sbjct:    1 MSQQQFKYIVRLFGQDVDGTMKLPYALAMIKGIGYNTAMIIIRKLNLDKDKRLGEISDEDIKKIENLLNNKIIPESPNWIYNRQKDYESGADMHLVTSDLIFYVRNDIERERRSRSWRGVRHS 123          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_METAC (30S ribosomal protein S13P OS=Methanosarcina acetivorans GN=rps13p PE=3 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 5.548e-19
Identity = 43/120 (35.83%), Postives = 71/120 (59.17%), Query Frame = 2
Query:   53 NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            NE+ +H++R++NT++ G + + +ALT + G+GRR A ++ K A VD +   G L   E+  L   +       +P W LNRQKD   G+   ++   + +  R+D+  LKK+R +RGLRH
Sbjct:   17 NEELRHLVRIMNTDLQGAKPVQYALTGLPGVGRRTAKLIAKGAGVDPSAILGYLPEEEVAKLDTAIGKFEDI-VPSWMLNRQKDLATGQDKHLLGTDILLTFREDINNLKKVRAYRGLRH 135          
The following BLAST results are available for this feature:
BLAST of DC900355 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 60
Match NameE-valueIdentityDescription
RS18_ENCCU1.321e-2040.1740S ribosomal protein S18 OS=Encephalitozoon cunic... [more]
RS13_STAMF2.253e-2036.1330S ribosomal protein S13P OS=Staphylothermus mari... [more]
RS13_THEVO2.942e-2035.8330S ribosomal protein S13P OS=Thermoplasma volcani... [more]
RS13_THEAC2.942e-2034.1730S ribosomal protein S13P OS=Thermoplasma acidoph... [more]
RS13_SULSO1.118e-1938.0230S ribosomal protein S13P OS=Sulfolobus solfatari... [more]
RS13_UNCMA1.460e-1936.9730S ribosomal protein S13P OS=Uncultured methanoge... [more]
RS13_NATPD2.490e-1937.5030S ribosomal protein S13P OS=Natronomonas pharaon... [more]
RS13_METTP2.490e-1939.8330S ribosomal protein S13P OS=Methanosaeta thermop... [more]
RS13_SULAC5.548e-1936.5930S ribosomal protein S13P OS=Sulfolobus acidocald... [more]
RS13_METAC5.548e-1935.8330S ribosomal protein S13P OS=Methanosarcina aceti... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900355 VSS Citrus sinensis cDNA clone VS28917 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900355 ID=DC900355|Name=DC900355|organism=Citrus sinensis|type=EST|length=455bp
CCTCTCTTCTCTTCATCATCAATCCTCACAATCGAAAATGTCTCTGGTGG
CGAACGAAGATTTTCAGCACATTTTGCGTGTGCTGAACACTAACGTCGAC
GGGAAGCAGAAGATTATGTTTGCTCTTACTTCAATTAAGGGTATTGGAAG
GCGACTGGCTAACATCGTTTGCAAGAAAGCTGATGTTGACATGAACAAGA
GGGCCGGTGAACTATCTGCTGCTGAACTTGACAATCTCATGGTCGTTGTT
GCAAATCCCCGACAGTTTAAAATCCCTGATTGGTTCTTGAACAGACAGAA
GGATTACAAAGATGGAAAGTATTCTCAGGTTGTATCCAATGCACTGGACA
TGAAGTTGAGAGATGATTTGGAGCGTCTGAAGAAGATCAGGAACCACCGT
GGTCTCAGGCACTCTGGGGTCTTCGTGTCCGTGGACACACACAGACACGC
GCGGA
back to top