DC900355

Overview
NameDC900355
Unique NameDC900355
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length455
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9788 contig Csv1_Contig9788:70..524. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_PYRIL (30S ribosomal protein S13P OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189) GN=rps13p PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 2.182e-15
Identity = 39/121 (32.23%), Postives = 76/121 (62.81%), Query Frame = 2
Query:   53 NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHS 415
            +++ + I+R+ +T++DG +++ ++LT I+GIG   A  +C+K  +D +   G LS  +++ L   V N  +   P WFLNR+KD + GK   ++   L +  + D++ +KK+++ +G+RHS
Sbjct:    2 SQEIRAIVRIGDTDLDGNKQVAYSLTKIRGIGIATAYAICRKLGIDPHAILGALSEEQINKLDWAVRNLHEL-APAWFLNRRKDPETGKDLHLIGAELVLAAKRDVDLMKKLKSWKGVRHS 121          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_METMJ (30S ribosomal protein S13P OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps13p PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.849e-15
Identity = 41/119 (34.45%), Postives = 69/119 (57.98%), Query Frame = 2
Query:   56 EDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            E+ ++ +RV NT++DG + +  ALT IKGIG   +  +   A VD +   G+L    +  +   V    + ++PDW +NRQKD   G+   ++   L M   DD+ R++K+R++RG+RH
Sbjct:    4 EEIKYFVRVRNTDLDGTKAVHIALTGIKGIGPHTSRTITALAAVDPHAILGKLDDESVGRIANAVDTYTE-QVPDWMVNRQKDVYTGEVRHLLGTDLTMMNDDDVNRMRKMRSYRGIRH 121          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_HALWD (30S ribosomal protein S13P OS=Haloquadratum walsbyi (strain DSM 16790) GN=rps13p PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.847e-14
Identity = 41/120 (34.17%), Postives = 68/120 (56.67%), Query Frame = 2
Query:   53 NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            ++D Q+ +R+  T++DG + +  +LT +KGIG+R A I+   A VD +   G L   E+D++   V N     IP W  NR++D+  G         L+ K R D+ R+K I +++G+RH
Sbjct:   15 DDDLQYFVRIGTTDLDGTKAVERSLTDMKGIGKRTARIITDVASVDRHATFGLLEEDEIDSITDAVEN-LDDHIPGWMTNRREDFFSGDTDHKTGADLEEKRRHDVNRMKMIDSYKGVRH 133          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_PYRCJ (30S ribosomal protein S13P OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps13p PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 3.150e-14
Identity = 37/120 (30.83%), Postives = 73/120 (60.83%), Query Frame = 2
Query:   56 EDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHS 415
            ++ + I+R+ +T++DG + + +AL  I+GIG   A  +C+K  +D +   G L   +++ L   V N  +   P WFLNR+KD + G+   ++ + L +  + D++ +KK+++ +G+RHS
Sbjct:    3 QEIRAIVRIGDTDLDGNKTVAYALAKIRGIGIATAYAICRKLGIDPHATLGLLPEDQINKLDWAVRNLHELA-PAWFLNRRKDPETGRDLHLIGSELVLAAKRDVDLMKKLKSWKGIRHS 121          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_METLZ (30S ribosomal protein S13P OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps13p PE=3 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 5.374e-14
Identity = 41/124 (33.06%), Postives = 68/124 (54.84%), Query Frame = 2
Query:   44 LVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNL-MVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            +V   + ++ +R++NT++DG Q +  ALT IKGIG   A I+ ++A VD     G L   ++  +   V A P    +P W +NR  D   G+   +  + L +   DD+  +KK+R +RG+RH
Sbjct:    1 MVEESELKYFVRIINTDLDGTQPVQLALTGIKGIGLHAALIIARRAGVDTRATMGLLGDEDVAAIEEQVKAYPA--SVPKWMVNRPVDVYSGEPKHLYGSDLSLAKEDDINLMKKMRCYRGIRH 122          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_PYRAE (30S ribosomal protein S13P OS=Pyrobaculum aerophilum GN=rps13p PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 9.166e-14
Identity = 37/121 (30.58%), Postives = 74/121 (61.16%), Query Frame = 2
Query:   53 NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHS 415
            +++ + I+R+ +T++DG +++ +AL  I+GIG   A  +C K  +D +   G L   +++ L   V N  +   P WFLNR+KD + G+   ++ + L +  + D++ +KK+++ +G+RHS
Sbjct:    2 SQEIRAIVRIGDTDLDGNKQVAYALAKIRGIGIASAYAICWKLGIDPHAILGALPEDQINKLDWAVRNLHELA-PAWFLNRRKDPETGRDLHLIGSELVLAAKRDVDLMKKLKSWKGVRHS 121          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_PYRAR (30S ribosomal protein S13P OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps13p PE=3 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.197e-13
Identity = 37/121 (30.58%), Postives = 74/121 (61.16%), Query Frame = 2
Query:   53 NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHS 415
            +++ + I+RV +T+++G +++ +AL  I+GIG   A  +C K  +D +   G L   +++ L   V N  +   P WFLNR+KD + G+   ++ + L +  + D++ +KK+++ +G+RHS
Sbjct:    2 SQELRAIVRVGDTDLEGNKQVAYALAKIRGIGIASAYAICWKLGIDPHAVLGALPEEQINKLDWAVRNLHEVA-PAWFLNRRKDPETGRDMHLIGSELVLAAKRDVDLMKKLKSWKGIRHS 121          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_CENSY (30S ribosomal protein S13P OS=Cenarchaeum symbiosum GN=rps13p PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.667e-13
Identity = 34/126 (26.98%), Postives = 72/126 (57.14%), Query Frame = 2
Query:   35 KMSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            K   ++ ++++HI+R+L  ++ G++K +  L  I+GIG   A  +     +D N   G L+  ++ ++  ++ +P     P WFLNR+KD + G+   + ++ ++  +R+D+ER +   + +G RH
Sbjct:   42 KRPRLSAQEYKHIVRILGNDLPGEKKAVVGLRQIRGIGYGFATAILDVLKIDNNSNIGYLTDEQVASIEKLLQDPAGAGFPTWFLNRRKDLETGEDRHIFTSDIEFTVRNDVERERVSGSWKGYRH 167          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_HALSA (30S ribosomal protein S13P OS=Halobacterium salinarium GN=rps13p PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 3.483e-13
Identity = 36/120 (30.00%), Postives = 67/120 (55.83%), Query Frame = 2
Query:   53 NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            +ED Q+ +R+  T++DG + +  AL  + G+GRR+A IV  +A VD     G L    ++++   V +  +   P W  NRQ D+  G+   +    +++    D+ R++ IR+++G+RH
Sbjct:   10 DEDIQYFVRIGQTDLDGTKTVERALAELGGVGRRVARIVADEAGVDRTATMGGLEDDAIESVTDAVDSFTE-HAPAWLANRQNDFYTGENQHITGTDVELTRDQDINRMRMIRSYKGIRH 128          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_NANEQ (30S ribosomal protein S13P OS=Nanoarchaeum equitans GN=rps13p PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.851e-12
Identity = 35/114 (30.70%), Postives = 61/114 (53.51%), Query Frame = 2
Query:   71 ILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            I+ + + ++DG + I   L  + G+    A+ VC    +D  ++ G LS  EL+ L   + NP ++ IP W  NR++D + GK   +V N   + +  D++R  +I + RG RH
Sbjct:   13 IVHIADVDLDGHKPIYVELRKVVGVNWMFAHAVCAALGIDKWRKIGSLSDEELEKLEDALRNPWKYGIPSWLYNRRRDPETGKDLHLVGNDYKITMEFDIKREMQINSWRGYRH 126          
The following BLAST results are available for this feature:
BLAST of DC900355 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 60
Match NameE-valueIdentityDescription
RS13_PYRIL2.182e-1532.2330S ribosomal protein S13P OS=Pyrobaculum islandic... [more]
RS13_METMJ2.849e-1534.4530S ribosomal protein S13P OS=Methanoculleus maris... [more]
RS13_HALWD1.847e-1434.1730S ribosomal protein S13P OS=Haloquadratum walsby... [more]
RS13_PYRCJ3.150e-1430.8330S ribosomal protein S13P OS=Pyrobaculum calidifo... [more]
RS13_METLZ5.374e-1433.0630S ribosomal protein S13P OS=Methanocorpusculum l... [more]
RS13_PYRAE9.166e-1430.5830S ribosomal protein S13P OS=Pyrobaculum aerophil... [more]
RS13_PYRAR1.197e-1330.5830S ribosomal protein S13P OS=Pyrobaculum arsenati... [more]
RS13_CENSY2.667e-1326.9830S ribosomal protein S13P OS=Cenarchaeum symbiosu... [more]
RS13_HALSA3.483e-1330.0030S ribosomal protein S13P OS=Halobacterium salina... [more]
RS13_NANEQ3.851e-1230.7030S ribosomal protein S13P OS=Nanoarchaeum equitan... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900355 VSS Citrus sinensis cDNA clone VS28917 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900355 ID=DC900355|Name=DC900355|organism=Citrus sinensis|type=EST|length=455bp
CCTCTCTTCTCTTCATCATCAATCCTCACAATCGAAAATGTCTCTGGTGG
CGAACGAAGATTTTCAGCACATTTTGCGTGTGCTGAACACTAACGTCGAC
GGGAAGCAGAAGATTATGTTTGCTCTTACTTCAATTAAGGGTATTGGAAG
GCGACTGGCTAACATCGTTTGCAAGAAAGCTGATGTTGACATGAACAAGA
GGGCCGGTGAACTATCTGCTGCTGAACTTGACAATCTCATGGTCGTTGTT
GCAAATCCCCGACAGTTTAAAATCCCTGATTGGTTCTTGAACAGACAGAA
GGATTACAAAGATGGAAAGTATTCTCAGGTTGTATCCAATGCACTGGACA
TGAAGTTGAGAGATGATTTGGAGCGTCTGAAGAAGATCAGGAACCACCGT
GGTCTCAGGCACTCTGGGGTCTTCGTGTCCGTGGACACACACAGACACGC
GCGGA
back to top