DC900349

Overview
NameDC900349
Unique NameDC900349
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1064
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: RL27A_BOVIN (60S ribosomal protein L27a OS=Bos taurus GN=RPL27A PE=2 SV=3)

HSP 1 Score: 90.8929 bits (224), Expect = 1.374e-17
Identity = 46/85 (54.12%), Postives = 61/85 (71.76%), Query Frame = 2
Query:    5 RNKFHCPIVNIDKLWSMVPQDVKAKASKDNV---PMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVLTA 250
            RN+  CP VN+DKLW++V +  +  A+K+     P+IDV + GY+KVLGKG LP+ QPV+VKAK  S+ AE+KIK  GGA VL A
Sbjct:   65 RNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPK-QPVIVKAKFFSRRAEEKIKGVGGACVLVA 148          
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: RL27A_PANTR (60S ribosomal protein L27a OS=Pan troglodytes GN=RPL27A PE=2 SV=3)

HSP 1 Score: 90.1225 bits (222), Expect = 2.343e-17
Identity = 45/83 (54.22%), Postives = 60/83 (72.29%), Query Frame = 2
Query:    5 RNKFHCPIVNIDKLWSMVPQDVKAKASKDNV---PMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVL 244
            RN+  CP VN+DKLW++V +  +  A+K+     P+IDV + GY+KVLGKG LP+ QPV+VKAK  S+ AE+KIK  GGA VL
Sbjct:   65 RNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPK-QPVIVKAKFFSRRAEEKIKSVGGACVL 146          
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: R27A2_ENTHI (60S ribosomal protein L27a-2/4 OS=Entamoeba histolytica GN=rpl27a-2 PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 3.060e-17
Identity = 44/85 (51.76%), Postives = 62/85 (72.94%), Query Frame = 2
Query:    8 NKFHCPIVNIDKLWSMVPQDVKAKASK----DNVPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVLTA 250
            NK++CP +N+D LWS+V +DV+A+       + VP+ID  + GYFKVLGKG LP+ QPV+V+A+  S+ A++KIK  GGA  LTA
Sbjct:   66 NKYYCPSINVDSLWSLVGKDVQAQYKNAKVGEEVPVIDCVKHGYFKVLGKGFLPK-QPVIVRARYFSEKAQQKIKAVGGACELTA 149          
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: R27A1_ENTHI (60S ribosomal protein L27a-1 OS=Entamoeba histolytica GN=rpl27a-1 PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 3.997e-17
Identity = 43/85 (50.59%), Postives = 62/85 (72.94%), Query Frame = 2
Query:    8 NKFHCPIVNIDKLWSMVPQDVKAKASK----DNVPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVLTA 250
            NK++CP +N+D LWS+V +D++A+       + VP+ID  + GYFKVLGKG LP+ QPV+V+A+  S+ A++KIK  GGA  LTA
Sbjct:   66 NKYYCPSINVDSLWSLVGKDIQAQYKNAKVGEEVPVIDCVKHGYFKVLGKGFLPK-QPVIVRARYFSEKAQQKIKAVGGACELTA 149          
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: RL27A_MOUSE (60S ribosomal protein L27a OS=Mus musculus GN=Rpl27a PE=2 SV=4)

HSP 1 Score: 88.1965 bits (217), Expect = 8.903e-17
Identity = 45/85 (52.94%), Postives = 60/85 (70.59%), Query Frame = 2
Query:    5 RNKFHCPIVNIDKLWSMVPQDVKAKASKDNV---PMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVLTA 250
            RN+  CP VN+DK W++V +  +  A+K+     P+IDV + GY+KVLGKG LP+ QPV+VKAK  S+ AE+KIK  GGA VL A
Sbjct:   65 RNQSFCPTVNLDKPWTLVSEQTRVNAAKNKTGVAPIIDVVRSGYYKVLGKGKLPK-QPVIVKAKFFSRRAEEKIKGVGGACVLVA 148          
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: R27A3_ENTHI (60S ribosomal protein L27a-3 OS=Entamoeba histolytica GN=rpl27a-3 PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 8.903e-17
Identity = 44/85 (51.76%), Postives = 61/85 (71.76%), Query Frame = 2
Query:    8 NKFHCPIVNIDKLWSMVPQDV----KAKASKDNVPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVLTA 250
            NK++CP +N+D LWS+V +DV    K   + + VP+ID  + GYFKVLGKG LP+ QPV+V+A+  S+ A++KIK  GGA  LTA
Sbjct:   66 NKYYCPSINVDSLWSLVGKDVQEQYKNAKTGEEVPVIDCVKHGYFKVLGKGFLPK-QPVIVRARYFSEKAQQKIKAVGGACELTA 149          
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: RL27A_XENLA (60S ribosomal protein L27a OS=Xenopus laevis GN=rpl27a PE=2 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 1.286e-15
Identity = 43/85 (50.59%), Postives = 58/85 (68.24%), Query Frame = 2
Query:    5 RNKFHCPIVNIDKLWSMVPQDVK---AKASKDNVPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVLTA 250
            +N+  CP +N+DKLW++V +  +   AK  +   P+ID    GY+KVLGKG LP+ QPV+VKAK  S+ AE+KIK  GGA VL A
Sbjct:   65 KNQSFCPTINLDKLWTLVSEQTRLNHAKNLEGPAPIIDAVHAGYYKVLGKGKLPK-QPVIVKAKFFSRKAEEKIKSVGGACVLGA 148          
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: R27A1_ARATH (Putative 60S ribosomal protein L27a-1 OS=Arabidopsis thaliana GN=RPL27AA PE=5 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 2.193e-15
Identity = 48/82 (58.54%), Postives = 51/82 (62.20%), Query Frame = 2
Query:    2 LRNKFHCPIVNIDKLWSMVPQDVKAKASKDNVPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVLT 247
            LRNKF+C IVN+DKLWSMV                          LGKG LPEN+PVVVKAKLVS T EKKIKEAG AVVLT
Sbjct:   45 LRNKFYCQIVNLDKLWSMV--------------------------LGKGFLPENKPVVVKAKLVSNTDEKKIKEAGSAVVLT 100          
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: RL28_YEAST (60S ribosomal protein L28 OS=Saccharomyces cerevisiae GN=RPL28 PE=1 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 3.741e-15
Identity = 42/83 (50.60%), Postives = 59/83 (71.08%), Query Frame = 2
Query:   14 FHCPIVNIDKLWSMVPQDVKAK----ASKDNVPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVLTA 250
            F  P++N+DKLW+++P+D + +    ASK+  P+ID    GY K+LGKG +P N PV+VKA+ VSK AE+KI+ AGG V L A
Sbjct:   68 FWKPVLNLDKLWTLIPEDKRDQYLKSASKETAPVIDTLAAGYGKILGKGRIP-NVPVIVKARFVSKLAEEKIRAAGGVVELIA 149          
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: RL28_NEUCR (60S ribosomal protein L28 OS=Neurospora crassa GN=rpl-28 PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 4.886e-15
Identity = 43/87 (49.43%), Postives = 60/87 (68.97%), Query Frame = 2
Query:    2 LRNKFHCPIVNIDKLWSMVPQDVKAK----ASKDNVPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVLTA 250
            LRN    PI+NI+KLW++VP + + K    A+ +  P+ID+   GY K+LGKG LP+  P+VV+A+ VS  AE+KIKEAGG + L A
Sbjct:   64 LRNHQWAPILNIEKLWTLVPAEAREKYVSGAATETAPVIDLLSHGYAKLLGKGRLPQ-VPIVVRARYVSAEAERKIKEAGGVIELVA 149          
The following BLAST results are available for this feature:
BLAST of DC900349 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
RL27A_BOVIN1.374e-1754.1260S ribosomal protein L27a OS=Bos taurus GN=RPL27A... [more]
RL27A_PANTR2.343e-1754.2260S ribosomal protein L27a OS=Pan troglodytes GN=R... [more]
R27A2_ENTHI3.060e-1751.7660S ribosomal protein L27a-2/4 OS=Entamoeba histol... [more]
R27A1_ENTHI3.997e-1750.5960S ribosomal protein L27a-1 OS=Entamoeba histolyt... [more]
RL27A_MOUSE8.903e-1752.9460S ribosomal protein L27a OS=Mus musculus GN=Rpl2... [more]
R27A3_ENTHI8.903e-1751.7660S ribosomal protein L27a-3 OS=Entamoeba histolyt... [more]
RL27A_XENLA1.286e-1550.5960S ribosomal protein L27a OS=Xenopus laevis GN=rp... [more]
R27A1_ARATH2.193e-1558.54Putative 60S ribosomal protein L27a-1 OS=Arabidops... [more]
RL28_YEAST3.741e-1550.6060S ribosomal protein L28 OS=Saccharomyces cerevis... [more]
RL28_NEUCR4.886e-1549.4360S ribosomal protein L28 OS=Neurospora crassa GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900349 VSS Citrus sinensis cDNA clone VS28908 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900349 ID=DC900349|Name=DC900349|organism=Citrus sinensis|type=EST|length=1064bp
ACTCCGCAACAAATTCCACTGCCCCATCGTCAACATCGACAAGCTCTGGT
CCATGGTCCCGCAAGATGTGAAAGCAAAGGCCAGCAAGGACAATGTTCCG
ATGATTGATGTCACTCAGTTCGGCTACTTTAAGGTTTTGGGCAAAGGTGT
TTTGCCGGAGAACCAGCCCGTCGTTGTCAAGGCCAAGCTCGTTTCTAAGA
CCGCTGAGAAGAAGATCAAAGAGGCTGGTGGCGCTGTTGTGCTCACAGCT
TAGGGTTATTTTGGTAACTCTCCCTTGTCTAGGGATTTTGTTTTATTCTG
GGATCTGTTGAGACTTATTTAAATCACAATGTTTTTATCTTTTTTTTTGG
GTATATCTCTCGCTTAATGATTAAATGTGACCTGAATCTCATTTTATTTG
ACTTCTTGGTGCATTTAAGCAGTTTTTTATAAAAAAGAAGCCTCAAATTA
AAGCTTTGTTTGGCATAATTAATCTCTCTCCCCATTTTCTTCTTATCTTG
GCTAATTAAACCTCCACTTTCATCATTCATGGCACAAAAAATTTTCATGT
TAACTCTCCTTGTGGTTCTCCTCCTAAGCAAAAGCTTTGATTTAATATCA
GCATCAAGGCCACCTCATATTCACCCACCAACTATCCCTAGAGGCTCTTT
GTTGAACAAGGTTAAACCTCCTTCTTTTCATGCATATACTGCAAATCGTT
ACAAGTTGACAGAATCAGAGGCTTTTCGCCCCACGAGTCCGGGACATAGC
CCTGGTGTTGGCCACAAAGGACCACCGGGTTCTGATTGAAGTAAGCCCTA
GCTAGCAGCACAGCTTGTTAGGTTTTCATATAGTATACACTTAAAATGAT
TGTTGTTTAAAAGATTGCTCATATGCATGCAACCAAATAATATGTCTTCT
AAAGGGTCCTCTCAAGTCTTGTTGACGAGTTAGGTTTTCAAATAGTTGAC
ATGCCACGGTATGAAGTTATATCTATGTGTAAACCAGATTTTGTTTATCA
TTGTTTTTGCTTTGAGCTCAACTCATATTATCGCTTTATATATTTTTGTT
TTGATGGGTATTTC
back to top