DC900349

Overview
NameDC900349
Unique NameDC900349
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1064
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: RL27A_DROME (60S ribosomal protein L27a OS=Drosophila melanogaster GN=RpL27A PE=2 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 9.214e-14
Identity = 42/85 (49.41%), Postives = 61/85 (71.76%), Query Frame = 2
Query:    5 RNKFHCPIVNIDKLWSMVPQDVKAKASKDN---VPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVLTA 250
            ++KF  P +N+DKLWS+V  +  A+  K+     P+ID+ +FGY+K+LG+G LP  +PV+VKAK  SK AE KIK+AGG  +L+A
Sbjct:   67 QHKFR-PEINLDKLWSLVGAEKFAELEKEKSTKAPVIDLVKFGYYKLLGRGHLPA-RPVIVKAKYFSKKAEDKIKKAGGVCLLSA 149          
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: RL28B_SCHPO (60S ribosomal protein L28-B OS=Schizosaccharomyces pombe GN=rpl28b PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 2.053e-13
Identity = 40/86 (46.51%), Postives = 58/86 (67.44%), Query Frame = 2
Query:    2 LRNKFHCPIVNIDKLWSMVPQDVKAKASKDNV---PMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVLTA 250
            ++N    P VN+D+LW++VP + + K    N    P+I+V Q GY KVLGKG LP+  PV+++ + VS+ AE+KIK+AGG V L A
Sbjct:   64 MKNPLWRPTVNLDRLWTLVPNETREKYLGKNTEVAPVINVLQSGYGKVLGKGRLPDT-PVIIQTRYVSRRAEEKIKQAGGVVELIA 148          
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: RL28A_SCHPO (60S ribosomal protein L28-A OS=Schizosaccharomyces pombe GN=rpl28a PE=2 SV=3)

HSP 1 Score: 77.0258 bits (188), Expect = 2.053e-13
Identity = 41/86 (47.67%), Postives = 58/86 (67.44%), Query Frame = 2
Query:    2 LRNKFHCPIVNIDKLWSMVPQDVKAKASKDNV---PMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVLTA 250
            ++N    P VN+D+LW+++P + + K    N    P+I+V Q GY KVLGKG LPE  PV+V+ + VS+ AE+KIK+AGG V L A
Sbjct:   64 MKNPLWRPTVNLDRLWTLLPNEARDKYLGKNTEVAPVINVLQSGYGKVLGKGRLPET-PVIVQTRYVSRRAEEKIKQAGGVVELIA 148          
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: RL27A_ERYGR (60S ribosomal protein L27a OS=Erysiphe graminis subsp. hordei PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 3.501e-13
Identity = 39/85 (45.88%), Postives = 58/85 (68.24%), Query Frame = 2
Query:    8 NKFHCPIVNIDKLWSMVPQDVK----AKASKDNVPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVLTA 250
            N F  P++N++KLWS++P + +    +  + D +P+ID+   GY KVLGKG +P+  P+VV+A+  SK AE+KI EAGG V L A
Sbjct:   66 NHFWKPVLNLEKLWSLIPAEKREAYLSSTNPDVIPVIDLLPLGYSKVLGKGRIPK-VPLVVRARWFSKEAERKITEAGGVVELVA 149          
The following BLAST results are available for this feature:
BLAST of DC900349 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
RL27A_DROME9.214e-1449.4160S ribosomal protein L27a OS=Drosophila melanogas... [more]
RL28B_SCHPO2.053e-1346.5160S ribosomal protein L28-B OS=Schizosaccharomyces... [more]
RL28A_SCHPO2.053e-1347.6760S ribosomal protein L28-A OS=Schizosaccharomyces... [more]
RL27A_ERYGR3.501e-1345.8860S ribosomal protein L27a OS=Erysiphe graminis su... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900349 VSS Citrus sinensis cDNA clone VS28908 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900349 ID=DC900349|Name=DC900349|organism=Citrus sinensis|type=EST|length=1064bp
ACTCCGCAACAAATTCCACTGCCCCATCGTCAACATCGACAAGCTCTGGT
CCATGGTCCCGCAAGATGTGAAAGCAAAGGCCAGCAAGGACAATGTTCCG
ATGATTGATGTCACTCAGTTCGGCTACTTTAAGGTTTTGGGCAAAGGTGT
TTTGCCGGAGAACCAGCCCGTCGTTGTCAAGGCCAAGCTCGTTTCTAAGA
CCGCTGAGAAGAAGATCAAAGAGGCTGGTGGCGCTGTTGTGCTCACAGCT
TAGGGTTATTTTGGTAACTCTCCCTTGTCTAGGGATTTTGTTTTATTCTG
GGATCTGTTGAGACTTATTTAAATCACAATGTTTTTATCTTTTTTTTTGG
GTATATCTCTCGCTTAATGATTAAATGTGACCTGAATCTCATTTTATTTG
ACTTCTTGGTGCATTTAAGCAGTTTTTTATAAAAAAGAAGCCTCAAATTA
AAGCTTTGTTTGGCATAATTAATCTCTCTCCCCATTTTCTTCTTATCTTG
GCTAATTAAACCTCCACTTTCATCATTCATGGCACAAAAAATTTTCATGT
TAACTCTCCTTGTGGTTCTCCTCCTAAGCAAAAGCTTTGATTTAATATCA
GCATCAAGGCCACCTCATATTCACCCACCAACTATCCCTAGAGGCTCTTT
GTTGAACAAGGTTAAACCTCCTTCTTTTCATGCATATACTGCAAATCGTT
ACAAGTTGACAGAATCAGAGGCTTTTCGCCCCACGAGTCCGGGACATAGC
CCTGGTGTTGGCCACAAAGGACCACCGGGTTCTGATTGAAGTAAGCCCTA
GCTAGCAGCACAGCTTGTTAGGTTTTCATATAGTATACACTTAAAATGAT
TGTTGTTTAAAAGATTGCTCATATGCATGCAACCAAATAATATGTCTTCT
AAAGGGTCCTCTCAAGTCTTGTTGACGAGTTAGGTTTTCAAATAGTTGAC
ATGCCACGGTATGAAGTTATATCTATGTGTAAACCAGATTTTGTTTATCA
TTGTTTTTGCTTTGAGCTCAACTCATATTATCGCTTTATATATTTTTGTT
TTGATGGGTATTTC
back to top