DC900348

Overview
NameDC900348
Unique NameDC900348
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length873
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900348_ssr731 microsatellite DC900348_ssr731:731..742. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig8249 contig Csv1_Contig8249:779..1651. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1G_DANRE (Elongation factor 1-gamma OS=Danio rerio GN=eef1g PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 6.835e-22
Identity = 52/144 (36.11%), Postives = 90/144 (62.50%), Query Frame = 3
Query:  240 SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYECY--DMELYDWKKVDINDEAQKERVSQMIEDHEPFEGE 665
            S  ++DE+KR YSN  T    VA+  FWD +D EG+S+W+ +Y++ +E T++F++ N + G  QR+D  RK AF  +++ G+     + G+W+FRGQ +  F + + +  D E Y W+K+D++ E  K     M++++  +EGE
Sbjct:  291 SSFVMDEFKRKYSNEDT--MTVALPYFWDHFDREGFSIWYAEYRFPEELTMAFMSCNLITGMFQRLDKLRKNAFASVILFGANNDSCISGIWVFRGQDL-AFPLSDDWQIDYESYTWRKLDVDSEECK----TMVKEYFAWEGE 427          
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1GA_XENLA (Elongation factor 1-gamma-A OS=Xenopus laevis GN=eef1g-A PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 4.431e-21
Identity = 66/234 (28.21%), Postives = 108/234 (46.15%), Query Frame = 3
Query:    6 VNIPNFRKILGEIKQ------------AESVPPVQSAKKPTQSXXXXXXXXXXXXXXXXXXXXXXXXXXDAGXXXXXXXXXXXXXXXXXXSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYECY--DMELYDWKKVDINDEAQKERVSQMIEDHEPFEGE 665
            VN P FR +LGE+K             AE  P  ++ KK   +                          ++                   S  I+DE+KR YSN  T    VA+  FW+ +D EG+S+W+ +YK+ +E T +F++ N + G  QR+D  RK  F  +++ G+     + G+W+FRGQ +  F + E +  D E Y+W+K+D   E  K     +++++  +EGE
Sbjct:  195 VNQPEFRAVLGEVKLCDKMAQFDAKKFAEMQPKKETPKKEKPAKEPKKEKEEKKKAAPTPAPAPEDDLDESEKALAAEPKSKDPYAHLPKSSFIMDEFKRKYSNEDT--LTVALPYFWEHFDKEGWSIWYAEYKFPEELTQAFMSCNLITGMFQRLDKLRKTGFASVILFGTNNNSSISGVWVFRGQDL-AFTLSEDWQIDYESYNWRKLDSGSEECK----TLVKEYFAWEGE 421          
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1G_RABIT (Elongation factor 1-gamma OS=Oryctolagus cuniculus GN=EEF1G PE=2 SV=3)

HSP 1 Score: 100.523 bits (249), Expect = 1.289e-20
Identity = 53/154 (34.42%), Postives = 87/154 (56.49%), Query Frame = 3
Query:  240 SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYEC-YDMELYDWKKVDINDEAQKERVSQMIEDHEPFE--GEALLDAKCFK 692
            S  +LDE+KR YSN  T    VA+  FW+ +D +G+SLW+ +Y++ +E T +F++ N + G  QR+D  RK AF  +++ G+     + G+W+FRGQ +   +  +   D E Y W+K+D + E  +  V +       F+  G+A    K FK
Sbjct:  286 STFVLDEFKRKYSNEDT--LSVALPYFWEHFDKDGWSLWYAEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGIWVFRGQELAFPLSPDWQVDYESYTWRKLDPSSEETQTLVREYFAWEGAFQHVGKAFNQGKVFK 437          
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1G_MOUSE (Elongation factor 1-gamma OS=Mus musculus GN=Eef1g PE=1 SV=3)

HSP 1 Score: 100.523 bits (249), Expect = 1.289e-20
Identity = 53/154 (34.42%), Postives = 87/154 (56.49%), Query Frame = 3
Query:  240 SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYEC-YDMELYDWKKVDINDEAQKERVSQMIEDHEPFE--GEALLDAKCFK 692
            S  +LDE+KR YSN  T    VA+  FW+ +D +G+SLW+ +Y++ +E T +F++ N + G  QR+D  RK AF  +++ G+     + G+W+FRGQ +   +  +   D E Y W+K+D   E  +  V +       F+  G+A+   K FK
Sbjct:  286 STFVLDEFKRKYSNEDT--LSVALPYFWEHFDKDGWSLWYAEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGTFQHVGKAVNQGKIFK 437          
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1G_RAT (Elongation factor 1-gamma OS=Rattus norvegicus GN=Eef1g PE=2 SV=3)

HSP 1 Score: 100.138 bits (248), Expect = 1.684e-20
Identity = 53/154 (34.42%), Postives = 87/154 (56.49%), Query Frame = 3
Query:  240 SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYEC-YDMELYDWKKVDINDEAQKERVSQMIEDHEPFE--GEALLDAKCFK 692
            S  +LDE+KR YSN  T    VA+  FW+ +D +G+SLW+ +Y++ +E T +F++ N + G  QR+D  RK AF  +++ G+     + G+W+FRGQ +   +  +   D E Y W+K+D   E  +  V +       F+  G+A+   K FK
Sbjct:  286 STFVLDEFKRKYSNEDT--LSVALPYFWEHFDKDGWSLWYAEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQDLAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAVNQGKIFK 437          
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1G_MACFA (Elongation factor 1-gamma OS=Macaca fascicularis GN=EEF1G PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 2.199e-20
Identity = 53/154 (34.42%), Postives = 86/154 (55.84%), Query Frame = 3
Query:  240 SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYEC-YDMELYDWKKVDINDEAQKERVSQMIEDHEPFE--GEALLDAKCFK 692
            S  +LDE+KR YSN  T    VA+  FW+ +D +G+SLW+ +Y++ +E T +F++ N + G  QR+D  RK AF  +++ G+     + G+W+FRGQ +   +  +   D E Y W+K+D   E  +  V +       F+  G+A    K FK
Sbjct:  286 STFVLDEFKRKYSNEDT--LSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK 437          
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1G_HUMAN (Elongation factor 1-gamma OS=Homo sapiens GN=EEF1G PE=1 SV=3)

HSP 1 Score: 99.7525 bits (247), Expect = 2.199e-20
Identity = 53/154 (34.42%), Postives = 86/154 (55.84%), Query Frame = 3
Query:  240 SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYEC-YDMELYDWKKVDINDEAQKERVSQMIEDHEPFE--GEALLDAKCFK 692
            S  +LDE+KR YSN  T    VA+  FW+ +D +G+SLW+ +Y++ +E T +F++ N + G  QR+D  RK AF  +++ G+     + G+W+FRGQ +   +  +   D E Y W+K+D   E  +  V +       F+  G+A    K FK
Sbjct:  286 STFVLDEFKRKYSNEDT--LSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK 437          
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1G_HORSE (Elongation factor 1-gamma OS=Equus caballus GN=EEF1G PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 2.199e-20
Identity = 53/154 (34.42%), Postives = 86/154 (55.84%), Query Frame = 3
Query:  240 SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYEC-YDMELYDWKKVDINDEAQKERVSQMIEDHEPFE--GEALLDAKCFK 692
            S  +LDE+KR YSN  T    VA+  FW+ +D +G+SLW+ +Y++ +E T +F++ N + G  QR+D  RK AF  +++ G+     + G+W+FRGQ +   +  +   D E Y W+K+D   E  +  V +       F+  G+A    K FK
Sbjct:  286 STFVLDEFKRKYSNEDT--LSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEEAQTLVREYFSWEGAFQHVGKAFNQGKIFK 437          
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1GB_XENLA (Elongation factor 1-gamma-B OS=Xenopus laevis GN=eef1g-B PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 2.199e-20
Identity = 67/242 (27.69%), Postives = 109/242 (45.04%), Query Frame = 3
Query:    6 VNIPNFRKILGEIKQ------------AESVPPVQSAKKPTQSXXXXXXXXXXXXXXXXXXXXXXXXXXDAGXXXXXXXXXXXXXXXXXXSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYECY--DMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKCF 689
            VN P FR +LGE+K             AE  P  ++ KK   +                          ++                   S  I+DE+KR YSN  T    VA+  FW+ ++ EG+S+W+ +YK+ +E T +F++ N + G  QR+D  RK AF  +++ G+     + G+W+FRG  +  F + E +  D E Y W+K+    E+  E    M++++  +EGE     K F
Sbjct:  196 VNQPEFRAVLGEVKLCDKMAQFDAKKFAEVQPKKETPKKEKPAKEPKKKKKKKKKATPAPAPAPEDDLDESEKALAAEPKSKDPYAHLPKSSFIMDEFKRKYSNEDT--LTVALPYFWEHFEKEGWSIWYAEYKFPEELTQTFMSCNLITGMFQRLDKLRKTAFASVILFGTNNNSTISGVWVFRGHDL-AFTLSEDWQIDYESYTWRKL----ESDSEECRTMVKEYFAWEGEFKHVGKAF 430          
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1G_PIG (Elongation factor 1-gamma (Fragment) OS=Sus scrofa GN=EEF1G PE=2 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 4.899e-20
Identity = 52/154 (33.77%), Postives = 86/154 (55.84%), Query Frame = 3
Query:  240 SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYEC-YDMELYDWKKVDINDEAQKERVSQMIEDHEPFE--GEALLDAKCFK 692
            S  +LDE+KR YSN  T    VA+  FW+ +D +G+SLW+ +Y++ +E T +F++ N + G  QR+D  RK AF  +++ G+     + G+W+FRGQ +   +  +   D E Y W+K+D   E  +  V +       ++  G+A    K FK
Sbjct:  281 STFVLDEFKRKYSNEDT--LSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAYQHVGKAFNQGKIFK 432          
The following BLAST results are available for this feature:
BLAST of DC900348 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
EF1G_DANRE6.835e-2236.11Elongation factor 1-gamma OS=Danio rerio GN=eef1g ... [more]
EF1GA_XENLA4.431e-2128.21Elongation factor 1-gamma-A OS=Xenopus laevis GN=e... [more]
EF1G_RABIT1.289e-2034.42Elongation factor 1-gamma OS=Oryctolagus cuniculus... [more]
EF1G_MOUSE1.289e-2034.42Elongation factor 1-gamma OS=Mus musculus GN=Eef1g... [more]
EF1G_RAT1.684e-2034.42Elongation factor 1-gamma OS=Rattus norvegicus GN=... [more]
EF1G_MACFA2.199e-2034.42Elongation factor 1-gamma OS=Macaca fascicularis G... [more]
EF1G_HUMAN2.199e-2034.42Elongation factor 1-gamma OS=Homo sapiens GN=EEF1G... [more]
EF1G_HORSE2.199e-2034.42Elongation factor 1-gamma OS=Equus caballus GN=EEF... [more]
EF1GB_XENLA2.199e-2027.69Elongation factor 1-gamma-B OS=Xenopus laevis GN=e... [more]
EF1G_PIG4.899e-2033.77Elongation factor 1-gamma (Fragment) OS=Sus scrofa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900348 VSS Citrus sinensis cDNA clone VS28907 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900348 ID=DC900348|Name=DC900348|organism=Citrus sinensis|type=EST|length=873bp
CAATGGTTAACATACCAAATTTCCGCAAGATATTGGGAGAGATAAAGCAA
GCAGAATCTGTCCCTCCTGTTCAGTCAGCGAAGAAGCCCACGCAGTCAAA
AGAGCCTGCAAAACCCAAGGCCCAGGCTGAGCCAAAGAAAGAGGCTGCAA
ANNAAACAGCAAAACCTAAAGTTGAAGACGCTGGTGAGGAAGAGGCACCA
AAGCCCAAGCCAAAGAATCCACTTGACCTTTTGCCTCCCAGCAAGATGAT
TTTGGATGAGTGGAAGAGGCTGTACTCAAACACAAAGACCAACTTTCGTG
AGGTTGCCATTAAAGGATTTTGGGACATGTATGATCCGGAGGGCTACTCT
CTTTGGTTCTGTGATTACAAGTACAATGATGAGAATACAGTCTCATTTGT
GACTTTGAACAAAGTGGGCGGATTCCTGCAGCGAATGGACTTGGCTCGTA
AGTATGCTTTTGGGAAGATGCTGGTTATTGGCTCGGAGCCACCTTTCAAG
GTAAAGGGTTTGTGGCTTTTCCGTGGACAAGTGATTCCTCAATTTATAAT
GTACGAGTGTTACGACATGGAGTTGTATGATTGGAAGAAGGTGGACATCA
ATGATGAAGCTCAGAAGGAGCGTGTAAGCCAGATGATCGAAGATCATGAA
CCTTTCGAGGGTGAGGCCTTGTTAGATGCCAAGTGCTTCAAGTGAGATCA
TCCAGATGGACCAGACCGGGGAAGTAGCTGGTGTGTGTGTGTAATGCTGT
TGCAATCATTTAAGTTTTCTAATTTTTCATCTTTAGTTTTGTGCTGTTAG
CAAATTGACCCTATTTAAGCATTCAATTGACTTTGATTTAAATACATCAG
AACTTTCTAGTTAATTTTCATAT
back to top