DC900348

Overview
NameDC900348
Unique NameDC900348
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length873
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900348_ssr731 microsatellite DC900348_ssr731:731..742. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig8249 contig Csv1_Contig8249:779..1651. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1G_CAEEL (Probable elongation factor 1-gamma OS=Caenorhabditis elegans GN=F17C11.9 PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 6.398e-20
Identity = 47/149 (31.54%), Postives = 85/149 (57.05%), Query Frame = 3
Query:  249 ILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYEC-YDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK 692
            +LD +KR YSN  T  +  AI  FW+ +D + +S+W C+YKY ++ T++F++ N + G  QR++  +K AF  M++ G++    + G+W+++G  +   +  +   D E Y W K+D   +A K+ V++ +     F G+     K FK
Sbjct:  252 VLDNFKRSYSNEDTATK--AIPHFWENFDADNWSIWKCEYKYPEDLTLAFMSCNLINGMYQRLEKLKKNAFASMILFGTDNNSTISGIWVWKGDKLAFELSPDWQVDYESYTWTKLDAKSDATKKEVNEYLMWEGDFGGKKFNQGKIFK 398          
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1G_BOVIN (Elongation factor 1-gamma OS=Bos taurus GN=EEF1G PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 8.356e-20
Identity = 54/154 (35.06%), Postives = 85/154 (55.19%), Query Frame = 3
Query:  240 SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYEC-YDMELYDWKKVDINDEAQKERVSQMIEDHEPFE--GEALLDAKCFK 692
            S  +LDE+KR YSN  T    VA+  FWD +D +G+SLW+ +Y++ +E T +F++ N + G  QR+D  RK AF  +++ G+     + G+W FRGQ +   +  +   D E Y W+K+D   E  +  V +       F+  G+A    K FK
Sbjct:  289 STFVLDEFKRKYSNEDT--LSVALPYFWDHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWDFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFCWEGAFQHVGKAFNQGKIFK 440          
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1G_DROME (Elongation factor 1-gamma OS=Drosophila melanogaster GN=Ef1gamma PE=1 SV=2)

HSP 1 Score: 96.2857 bits (238), Expect = 2.431e-19
Identity = 48/127 (37.80%), Postives = 76/127 (59.84%), Query Frame = 3
Query:  255 DEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYEC-YDMELYDWKKVDINDEAQKERVSQ 632
            D++KR+YSN        +I  F+D +D E YS+WF +YKYN+E +  F++ N + G  QR+D  RK AF  + + G +    + G+W++RGQ +   +  +   D E+YDWKK+D   E  K+ V+Q
Sbjct:  287 DDFKRVYSNED---EAKSIPYFFDKFDAENYSIWFGEYKYNEELSKVFMSCNLITGMFQRLDKMRKAAFASVCLFGEDGNSTISGIWVWRGQDLAFTLSPDWQIDYEVYDWKKLDAKSEETKKLVTQ 410          
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1G_ARTSA (Elongation factor 1-gamma OS=Artemia salina PE=1 SV=3)

HSP 1 Score: 95.1301 bits (235), Expect = 5.416e-19
Identity = 46/128 (35.94%), Postives = 75/128 (58.59%), Query Frame = 3
Query:  252 LDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYEC-YDMELYDWKKVDINDEAQKERVSQ 632
            +D++KR YSN   N    +I  FW+ +D E YS+W+ +YKY DE    +++ N + G  QR++  RK AF  + V G +    + G+W++RGQ +   +  +   D E YDWKK+D + +  K+ V+Q
Sbjct:  285 MDDFKRFYSN---NEETKSIPYFWEKFDKENYSIWYSEYKYQDELAKVYMSCNLITGMFQRIEKMRKQAFASVCVFGEDNDSSISGIWVWRGQDLAFKLSPDWQIDYESYDWKKLDPDAQETKDLVTQ 409          
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1G_SCHPO (Elongation factor 1-gamma OS=Schizosaccharomyces pombe GN=tef3 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 3.881e-17
Identity = 53/149 (35.57%), Postives = 79/149 (53.02%), Query Frame = 3
Query:  252 LDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKY-NDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG-QVIPQFIMYECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK 692
            ++E+KR+YSN  T  R  A+  F++ +DPE YS+W  DY Y  D     F+T N +GGF QR++ +RKY FG  +VIG      + G ++ +G   +P F +    D   Y + K+DIN    K  +       +P EG  + D K  K
Sbjct:  265 IEEYKRVYSNQDT--RSGALPWFFEHFDPENYSVWKVDYSYPEDLKQPVFMTNNLIGGFFQRLEASRKYIFGCCVVIGENGDNTITGAFVIKGHDYVPAFDV--APDWGSYTFTKLDINKPEDKAFIEDAWAWDKPIEGREVADGKVCK 409          
The following BLAST results are available for this feature:
BLAST of DC900348 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
EF1G_CAEEL6.398e-2031.54Probable elongation factor 1-gamma OS=Caenorhabdit... [more]
EF1G_BOVIN8.356e-2035.06Elongation factor 1-gamma OS=Bos taurus GN=EEF1G P... [more]
EF1G_DROME2.431e-1937.80Elongation factor 1-gamma OS=Drosophila melanogast... [more]
EF1G_ARTSA5.416e-1935.94Elongation factor 1-gamma OS=Artemia salina PE=1 S... [more]
EF1G_SCHPO3.881e-1735.57Elongation factor 1-gamma OS=Schizosaccharomyces p... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900348 VSS Citrus sinensis cDNA clone VS28907 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900348 ID=DC900348|Name=DC900348|organism=Citrus sinensis|type=EST|length=873bp
CAATGGTTAACATACCAAATTTCCGCAAGATATTGGGAGAGATAAAGCAA
GCAGAATCTGTCCCTCCTGTTCAGTCAGCGAAGAAGCCCACGCAGTCAAA
AGAGCCTGCAAAACCCAAGGCCCAGGCTGAGCCAAAGAAAGAGGCTGCAA
ANNAAACAGCAAAACCTAAAGTTGAAGACGCTGGTGAGGAAGAGGCACCA
AAGCCCAAGCCAAAGAATCCACTTGACCTTTTGCCTCCCAGCAAGATGAT
TTTGGATGAGTGGAAGAGGCTGTACTCAAACACAAAGACCAACTTTCGTG
AGGTTGCCATTAAAGGATTTTGGGACATGTATGATCCGGAGGGCTACTCT
CTTTGGTTCTGTGATTACAAGTACAATGATGAGAATACAGTCTCATTTGT
GACTTTGAACAAAGTGGGCGGATTCCTGCAGCGAATGGACTTGGCTCGTA
AGTATGCTTTTGGGAAGATGCTGGTTATTGGCTCGGAGCCACCTTTCAAG
GTAAAGGGTTTGTGGCTTTTCCGTGGACAAGTGATTCCTCAATTTATAAT
GTACGAGTGTTACGACATGGAGTTGTATGATTGGAAGAAGGTGGACATCA
ATGATGAAGCTCAGAAGGAGCGTGTAAGCCAGATGATCGAAGATCATGAA
CCTTTCGAGGGTGAGGCCTTGTTAGATGCCAAGTGCTTCAAGTGAGATCA
TCCAGATGGACCAGACCGGGGAAGTAGCTGGTGTGTGTGTGTAATGCTGT
TGCAATCATTTAAGTTTTCTAATTTTTCATCTTTAGTTTTGTGCTGTTAG
CAAATTGACCCTATTTAAGCATTCAATTGACTTTGATTTAAATACATCAG
AACTTTCTAGTTAATTTTCATAT
back to top