DC900342

Overview
NameDC900342
Unique NameDC900342
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1211
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12689 contig Csv1_Contig12689:61..1271. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_XANCP (Chaperone protein clpB OS=Xanthomonas campestris pv. campestris GN=clpB PE=3 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 1.778e-96
Identity = 169/274 (61.68%), Postives = 221/274 (80.66%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            VVGQ+ A+K V++A++RSRAGLSDP+RP  SF+F+GPTGVGKTEL KALA ++F++ EA++RIDMSE+MEKH+VSRLIGAPPGYVGYEEGG LTE VRRRPY++IL DE+EKAH+DVFN+ LQ+LDDGR+TD QGRTV F NTVI+MTSN+GS  I  +  +      AY  +K  VM   +  FRPEF+NR+D+ +VF PLD+ QI SI R+QL  ++KR+A+R +K+ + D A++LLG++G+DP YGARP+KR IQ  VEN LA+ IL G++
Sbjct:  570 VVGQEEAIKVVSDAVRRSRAGLSDPNRPSGSFLFLGPTGVGKTELCKALADFLFDSTEAMIRIDMSEFMEKHSVSRLIGAPPGYVGYEEGGYLTEAVRRRPYSLILLDEVEKAHADVFNILLQVLDDGRLTDGQGRTVDFRNTVIVMTSNLGSHQIQELSGD--GSAEAYTQMKAAVMGVVQAHFRPEFINRLDDIVVFHPLDKAQIKSIARIQLQGLEKRLAERGLKLDLDDPALELLGNVGFDPVYGARPLKRAIQSQVENPLAQQILSGQY 841          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_XANAC (Chaperone protein clpB OS=Xanthomonas axonopodis pv. citri GN=clpB PE=3 SV=2)

HSP 1 Score: 353.214 bits (905), Expect = 1.778e-96
Identity = 169/274 (61.68%), Postives = 221/274 (80.66%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            VVGQ+ A+K V++A++RSRAGLSDP+RP  SF+F+GPTGVGKTEL KALA ++F++ EA++RIDMSE+MEKH+V+RLIGAPPGYVGYEEGG LTE VRRRPY++IL DE+EKAH DVFN+ LQ+LDDGR+TD QGRTV F NTVI+MTSN+GS  I  +  +      AY  +K  VM   +  FRPEF+NR+D+ +VF PLD+ QI SI R+QL  ++KR+A+R +K+ + DAA+++LGS+G+DP YGARP+KR IQ  VEN LA+ IL G++
Sbjct:  570 VVGQNEAIKVVSDAVRRSRAGLSDPNRPSGSFLFLGPTGVGKTELCKALADFLFDSTEAMIRIDMSEFMEKHSVARLIGAPPGYVGYEEGGYLTEAVRRRPYSLILLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFRNTVIVMTSNLGSHQIQELSGD--DSAEAYTQMKAAVMGVVQAHFRPEFINRLDDIVVFHPLDKAQIKSIARIQLQGLEKRLAERGLKLDLDDAALEVLGSVGFDPVYGARPLKRAIQSQVENPLAQQILSGQY 841          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_THET8 (Chaperone protein clpB OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=clpB PE=1 SV=2)

HSP 1 Score: 353.214 bits (905), Expect = 1.778e-96
Identity = 175/275 (63.64%), Postives = 221/275 (80.36%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEFK 885
            VVGQD A+++VA+AI+R+RAGL DP+RPI SF+F+GPTGVGKTELAK LA+ +F+TEEA++RIDM+EYMEKHAVSRLIGAPPGYVGYEEGGQLTE VRRRPY+VILFDEIEKAH DVFN+ LQILDDGR+TDS GRTV F NTVII+TSN+GS  IL    E   K   YE I+  V    +  FRPEF+NR+DE +VF+PL ++QI  IV +QL  ++ R+A++++ +++T+AA   L   GYDP +GARP++RVIQ+ +E  LA+ IL GE K
Sbjct:  560 VVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPPGYVGYEEGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLIL----EGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVK 830          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_THET2 (Chaperone protein clpB OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=clpB PE=3 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 1.778e-96
Identity = 175/275 (63.64%), Postives = 221/275 (80.36%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEFK 885
            VVGQD A+++VA+AI+R+RAGL DP+RPI SF+F+GPTGVGKTELAK LA+ +F+TEEA++RIDM+EYMEKHAVSRLIGAPPGYVGYEEGGQLTE VRRRPY+VILFDEIEKAH DVFN+ LQILDDGR+TDS GRTV F NTVII+TSN+GS  IL    E   K   YE I+  V    +  FRPEF+NR+DE +VF+PL ++QI  IV +QL  ++ R+A++++ +++T+AA   L   GYDP +GARP++RVIQ+ +E  LA+ IL GE K
Sbjct:  560 VVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPPGYVGYEEGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLIL----EGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVK 830          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_XYLFT (Chaperone protein clpB OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=clpB PE=3 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 6.757e-96
Identity = 167/274 (60.95%), Postives = 221/274 (80.66%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            VVGQD A+K V++A++RSR GLSDP+RP  SF+F+GPTGVGKTEL KALA ++F++++A+VRIDMSE+MEKH+V+RLIGAPPGYVGYEEGG LTE+VRRRPY++IL DE+EKAHSDVFN+ LQ+LDDGR+TD QGRTV F NTVI+MTSN+GS  I  +  +  P+   Y  +K  VM   +  FRPEF+NR+D+ +VF PLD+ QI  I R+QL  ++KR+A+ ++K+ + D A++LLG++G+DP YGARP+KR IQ  +EN LA+ IL G F
Sbjct:  570 VVGQDEAIKVVSDAVRRSRTGLSDPNRPSGSFLFLGPTGVGKTELCKALAEFLFDSQDAMVRIDMSEFMEKHSVARLIGAPPGYVGYEEGGYLTELVRRRPYSLILLDEVEKAHSDVFNILLQVLDDGRLTDGQGRTVDFRNTVIVMTSNLGSHQIQELSGDDSPE--VYTQMKAAVMGVVQAHFRPEFINRLDDIVVFHPLDKAQIKQIARIQLRGLEKRLAESELKLDLDDRALELLGNVGFDPVYGARPLKRAIQSQLENALAQQILAGAF 841          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_COXBU (Chaperone protein clpB OS=Coxiella burnetii GN=clpB PE=3 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 6.757e-96
Identity = 169/274 (61.68%), Postives = 218/274 (79.56%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            V+GQD AV +VA AI+RSRAGLSDP+RP+ SF+F+GPTGVGKTEL KALA ++F+TE+A+VRIDMSE+MEKH+V+RLIGAPPGYVGYEEGG LTE +RRRPY+VIL DEIEKAH+DVFNV LQ+LDDGR+TD QGRTV F NTVI+MTSN+GS  I     E       Y+ +K  VM+     FRPEF+NR+DE +VF  L ++QI +I  +Q+DR++KR+ ++  ++ ++D A+  L  LGYDP YGARP+KRV+QQ +EN L++ IL G+F
Sbjct:  572 VIGQDEAVNAVANAIRRSRAGLSDPNRPVGSFLFLGPTGVGKTELCKALAVFLFDTEDAMVRIDMSEFMEKHSVARLIGAPPGYVGYEEGGYLTEAIRRRPYSVILLDEIEKAHNDVFNVLLQVLDDGRLTDGQGRTVDFRNTVIVMTSNLGSDLIREFSGEN------YDKMKDAVMEVVAQHFRPEFINRIDEAVVFHSLKKEQIRNIAIIQIDRIKKRLKEKDYQLTISDDALDYLSELGYDPVYGARPLKRVLQQQLENPLSQKILEGKF 839          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_VIBCH (Chaperone protein clpB OS=Vibrio cholerae GN=clpB PE=3 SV=1)

HSP 1 Score: 350.132 bits (897), Expect = 1.505e-95
Identity = 171/274 (62.41%), Postives = 220/274 (80.29%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            V+GQ  AV+ VA AI+RSRAGLSDP+RPI SF+F+GPTGVGKTEL K LA+++F++E+A+VR+DMSE+MEKH+V+RL+GAPPGYVGYEEGG LTE VRR+PY+VIL DE+EKAH DVFN+ LQ+LDDGR+TD QGRTV F NTV+IMTSN+GS  I     E F +   Y+ IK++VMD     FRPEF+NRVDE +VF PL ++ I SI  +QL R+++R+A+R  +++V D A+ L+  +G+DP YGARP+KR IQQ VEN LAK IL G+F
Sbjct:  570 VIGQKEAVEVVANAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCKTLANFLFDSEDAMVRVDMSEFMEKHSVARLVGAPPGYVGYEEGGYLTEAVRRKPYSVILLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFRNTVVIMTSNLGSSRI----QENFAR-LDYQGIKEQVMDVVSKHFRPEFLNRVDESVVFHPLGQEHIKSIASIQLARLRQRLAERDYQLEVDDEALDLIAHVGFDPVYGARPLKRAIQQNVENPLAKSILAGKF 838          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_VIBPA (Chaperone protein clpB OS=Vibrio parahaemolyticus GN=clpB PE=3 SV=1)

HSP 1 Score: 348.977 bits (894), Expect = 3.353e-95
Identity = 173/273 (63.37%), Postives = 215/273 (78.75%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            VVGQ  AV  V+ AI+RSRAGLSDP+RPI SF+F+GPTGVGKTEL K LAS+MF++E+A+VRIDMSE+MEKH+V+RL+GAPPGYVGYEEGG LTE VRR+PY+VIL DE+EKAH DVFN+ LQ+LDDGR+TD QGRTV F NTV+IMTSN+GS  I     E F     Y+ IK  VMD     FRPEF+NRVDE +VF PL ++ I SI  +QL+R+ KR+ ++  +++V+D A+ L+  +G+DP YGARP+KR IQQ VEN LAK IL GE
Sbjct:  570 VVGQSEAVAVVSNAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCKTLASFMFDSEDAMVRIDMSEFMEKHSVARLVGAPPGYVGYEEGGYLTEAVRRKPYSVILLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFRNTVVIMTSNLGSSRI----QENF-ATLDYQGIKSEVMDVVSKHFRPEFLNRVDEIVVFHPLGQEHIKSIASIQLERLAKRLEEKGYQLEVSDKALDLIAQVGFDPVYGARPLKRAIQQNVENPLAKSILAGE 837          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_XYLFA (Chaperone protein clpB OS=Xylella fastidiosa GN=clpB PE=3 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 4.380e-95
Identity = 165/274 (60.22%), Postives = 221/274 (80.66%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            VVGQ+ A+K V++A++RSR GLSDP+RP  SF+F+GPTGVGKTEL KALA ++F++++A+VRIDMSE+MEKH+V+RLIGAPPGYVGYEEGG LTE+VRRRPY++IL DE+EKAHSDVFN+ LQ+LDDGR+TD QGRTV F NTVI+MTSN+GS  I  +  +  P+   Y  +K  VM+  +  FRPEF+NR+D+ +VF PLD+ QI  I R+QL  ++KR+A+ ++K+ + D A++LLG++G+DP YGARP+KR IQ  +EN LA+ IL   F
Sbjct:  570 VVGQEEAIKVVSDAVRRSRTGLSDPNRPSGSFLFLGPTGVGKTELCKALAEFLFDSQDAMVRIDMSEFMEKHSVARLIGAPPGYVGYEEGGYLTELVRRRPYSLILLDEVEKAHSDVFNILLQVLDDGRLTDGQGRTVDFRNTVIVMTSNLGSHQIQELSGDDSPE--VYTQMKAAVMEVVQAHFRPEFINRLDDIVVFHPLDKAQIKQIARIQLQGLEKRLAESELKLDLDDRALELLGNVGFDPVYGARPLKRAIQSQLENPLAQQILAEAF 841          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_DEIRA (Chaperone protein clpB OS=Deinococcus radiodurans GN=clpB PE=3 SV=2)

HSP 1 Score: 347.821 bits (891), Expect = 7.470e-95
Identity = 173/275 (62.91%), Postives = 217/275 (78.91%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEFK 885
            V+GQD A+ SV++AI+R+RAGL+DP+RP+ SFMF+GP+GVGKTELAKALA ++F++ +A+VRIDMSEYMEKH V+RLIGAPPGYVG+EEGGQLTE VRRRPYAVILFDEIEKAH DVFNV LQ+LDDGR+TD QGRTV F NT+IIMTSN+GS  IL M      +    ETIK  VMD  R  FRPEF+NRVD+ IVF  L    + SIV +QL  +++R+A+R++ + +T+ A   L  LGYDP YGARP++R I QY+E  LA+ IL G+ +
Sbjct:  560 VIGQDRAIVSVSDAIRRARAGLNDPNRPLGSFMFLGPSGVGKTELAKALAEFLFDSSDAMVRIDMSEYMEKHTVARLIGAPPGYVGFEEGGQLTEAVRRRPYAVILFDEIEKAHPDVFNVLLQVLDDGRLTDGQGRTVDFRNTLIIMTSNIGSPLILEMQQ----RGEDAETIKSAVMDELRGEFRPEFLNRVDDIIVFDALTAKDLQSIVDIQLGGLRRRLAERRITLHLTEDAKDKLAELGYDPAYGARPLRRTISQYIETPLAREILGGQIQ 830          
The following BLAST results are available for this feature:
BLAST of DC900342 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 200
Match NameE-valueIdentityDescription
CLPB_XANCP1.778e-9661.68Chaperone protein clpB OS=Xanthomonas campestris p... [more]
CLPB_XANAC1.778e-9661.68Chaperone protein clpB OS=Xanthomonas axonopodis p... [more]
CLPB_THET81.778e-9663.64Chaperone protein clpB OS=Thermus thermophilus (st... [more]
CLPB_THET21.778e-9663.64Chaperone protein clpB OS=Thermus thermophilus (st... [more]
CLPB_XYLFT6.757e-9660.95Chaperone protein clpB OS=Xylella fastidiosa (stra... [more]
CLPB_COXBU6.757e-9661.68Chaperone protein clpB OS=Coxiella burnetii GN=clp... [more]
CLPB_VIBCH1.505e-9562.41Chaperone protein clpB OS=Vibrio cholerae GN=clpB ... [more]
CLPB_VIBPA3.353e-9563.37Chaperone protein clpB OS=Vibrio parahaemolyticus ... [more]
CLPB_XYLFA4.380e-9560.22Chaperone protein clpB OS=Xylella fastidiosa GN=cl... [more]
CLPB_DEIRA7.470e-9562.91Chaperone protein clpB OS=Deinococcus radiodurans ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900342 VSS Citrus sinensis cDNA clone VS28693 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900342 ID=DC900342|Name=DC900342|organism=Citrus sinensis|type=EST|length=1211bp
AAGCTTCAACAATCAGAGAGGGAGAAGCTGTTACATTTGGAGGAAGAGCT
GCACAAACGTGTTGTGGGTCAAGATCCAGCAGTGAAATCAGTAGCTGAGG
CGATTCAGCGATCTCGAGCAGGTCTTTCTGATCCTCACCGTCCAATAGCT
AGTTTCATGTTCATGGGTCCAACTGGTGTTGGAAAGACTGAACTGGCTAA
GGCACTAGCTTCCTACATGTTCAACACTGAAGAGGCCCTTGTACGAATTG
ATATGAGTGAGTATATGGAAAAGCATGCTGTTTCAAGATTGATTGGAGCC
CCACCTGGTTATGTGGGATATGAGGAAGGAGGACAGTTGACGGAGGTAGT
TCGCCGTAGGCCCTATGCAGTAATTCTGTTCGACGAGATTGAGAAGGCCC
ACTCTGATGTATTTAATGTGTTTCTTCAAATTCTGGATGATGGGAGAGTT
ACTGATTCACAGGGTCGTACTGTGAGTTTCACCAATACTGTCATCATTAT
GACTTCAAACGTGGGTTCACAATACATACTTAATATGGATGATGAGACAT
TCCCGAAGGAGACAGCCTATGAAACTATCAAACAGCGGGTAATGGATGCT
GCAAGATTAATATTCCGCCCCGAGTTCATGAACCGAGTAGATGAGTATAT
AGTATTCCAACCACTGGACCGTGACCAGATAAGCAGTATTGTGAGGTTAC
AGTTGGATCGGGTGCAGAAGAGGATTGCAGACCGGAAGATGAAAATGCAA
GTGACCGATGCAGCTATTCAGCTCCTTGGGAGTCTTGGGTATGACCCCAA
CTATGGTGCAAGGCCGGTCAAGAGGGTGATTCAGCAGTACGTTGAAAATG
AGCTTGCCAAGGGCATTCTGAGAGGGGAGTTCAAGGATGATGACACAATT
GTAACAGACACTGAAGTTACAGCATTTTCCAATGGCCAGCTTCCGCAGCA
AAAGCTAGTCTTCAGGAGACTTGATACCAGTTCGGATGCTTCTGCTGCAG
ATAACCAAGAAGCTTTCTCACAGACAGCATAAATGTCTGTCCAATGTGTT
TAATTTTACGAAATTATATTTGTGTTCAGCAAAATTATGAGCGAATTTTC
TTAACTGATAGGCTGTAACCTGCTTCTTGTATATGATGATGCTTTATACA
AAATCATAAGCCTTGAAGTGTTTCTTTTTCAACGATCATCACAAATTCAC
ATTCGTTTTAT
back to top