DC900342

Overview
NameDC900342
Unique NameDC900342
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1211
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12689 contig Csv1_Contig12689:61..1271. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPA_ECOL6 (ATP-dependent Clp protease ATP-binding subunit clpA OS=Escherichia coli O6 GN=clpA PE=3 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 8.627e-59
Identity = 120/272 (44.12%), Postives = 171/272 (62.87%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRG 876
            V GQD A++++ EAI+ +RAGL   H+P+ SF+F GPTGVGKTE+   L+  +      L+R DMSEYME+H VSRLIGAPPGYVG+++GG LT+ V + P+AV+L DEIEKAH DVFN+ LQ++D+G +TD+ GR   F N V++MT+N G +     + E       ++      M+  + IF PEF NR+D  I F  L  D I  +V   +  +Q ++  + + ++V+  A   L   GYD   GARP+ RVIQ  ++  LA  +L G
Sbjct:  460 VFGQDKAIEALTEAIKMARAGLGHEHKPVGSFLFAGPTGVGKTEVTVQLSKAL---GIELLRFDMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDAVIKHPHAVLLLDEIEKAHPDVFNILLQVMDNGTLTDNNGRKADFRNVVLVMTTNAGVR-----ETERKSIGLIHQDNSTDAMEEIKKIFTPEFRNRLDNIIWFDHLSTDVIHQVVDKFIVELQVQLDQKGVSLEVSQEARNWLAEKGYDRAMGARPMARVIQDNLKKPLANELLFG 723          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPA_ECO57 (ATP-dependent Clp protease ATP-binding subunit clpA OS=Escherichia coli O157:H7 GN=clpA PE=3 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 8.627e-59
Identity = 120/272 (44.12%), Postives = 171/272 (62.87%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRG 876
            V GQD A++++ EAI+ +RAGL   H+P+ SF+F GPTGVGKTE+   L+  +      L+R DMSEYME+H VSRLIGAPPGYVG+++GG LT+ V + P+AV+L DEIEKAH DVFN+ LQ++D+G +TD+ GR   F N V++MT+N G +     + E       ++      M+  + IF PEF NR+D  I F  L  D I  +V   +  +Q ++  + + ++V+  A   L   GYD   GARP+ RVIQ  ++  LA  +L G
Sbjct:  460 VFGQDKAIEALTEAIKMARAGLGHEHKPVGSFLFAGPTGVGKTEVTVQLSKAL---GIELLRFDMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDAVIKHPHAVLLLDEIEKAHPDVFNILLQVMDNGTLTDNNGRKADFRNVVLVMTTNAGVR-----ETERKSIGLIHQDNSTDAMEEIKKIFTPEFRNRLDNIIWFDHLSTDVIHQVVDKFIVELQVQLDQKGVSLEVSQEARNWLAEKGYDRAMGARPMARVIQDNLKKPLANELLFG 723          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_YEREN (Chaperone protein clpB OS=Yersinia enterocolitica GN=clpB PE=3 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 4.734e-57
Identity = 119/274 (43.43%), Postives = 175/274 (63.87%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNM--DDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRI-ADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILR 873
            V+GQ  A+  ++E I  +RAG++DP +P+  FM +GP+GVGKTE A A+A  M+  E+ L+ I+MSEY E H VS L G+PPGYVGY EGG LTE VRR+PY+V+L DEIEKAHSDV  +F Q+ D G++ D +GR + F NT++++TSNVGS+ + N+  D +T P +   + I   +      +F   F+ RV   I + PL +  +  IVRL LDR+ +R+ +  ++ +Q +D  +  + S       GAR + R I+Q +  E+ K ILR
Sbjct:  591 VIGQPHALVQLSENIMTARAGMADPRKPLGVFMLVGPSGVGKTETALAIAESMYGGEQNLITINMSEYQESHTVSSLKGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEIEKAHSDVHELFFQVFDKGQMEDGEGRFIDFKNTILLLTSNVGSELLSNLFADPDTAPDQ---DGILSALQPELLKVFPAAFLGRV-TVIPYLPLQQSALQHIVRLHLDRIGQRLQSQHQLTLQYSDVVVDDVVSRCSVAETGARMLIRYIEQNITPEIGKFILR 860          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPV1_PSEAE (Protein clpV1 OS=Pseudomonas aeruginosa GN=clpV1 PE=1 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 4.899e-54
Identity = 111/273 (40.66%), Postives = 170/273 (62.27%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNM--DDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRI-ADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGIL 870
            ++GQD A++ +A+ IQ SRAGL +P +PI  FM  G +GVGKTE A ALA  M+  E+ ++ I+MSE+ E H VS L GAPPGY+GY EGG LTE VRR+PY+V+L DE+EKAH DV  +F Q+ D G + D +GR + F NT+I++T+N G++ I ++  D E  P+    E I + + +    IF P  + R+   I + PL  D + +I RLQL R++KR+ A  K+  +  +  + L+ S   +   G R +  ++   +  ++++  L
Sbjct:  605 IIGQDHALEMIAKRIQTSRAGLDNPSKPIGVFMLAGTSGVGKTETALALAEAMYGGEQNVITINMSEFQEAHTVSTLKGAPPGYIGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVHEIFFQVFDKGVMEDGEGRVIDFKNTLILLTTNAGTEMIASLCADPELMPEP---EAIAKSLREPLLKIFPPALLGRL-VTIPYYPLSDDMLKAISRLQLGRIKKRVEATHKVPFEFDEGVVDLIVSRCTETESGGRMIDAILTNTLLPDMSREFL 873          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_HUMAN (Caseinolytic peptidase B protein homolog OS=Homo sapiens GN=CLPB PE=1 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 8.948e-48
Identity = 106/290 (36.55%), Postives = 168/290 (57.93%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMF-NTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGS----QYILNMDDETF-----------------PKETAYETIKQRVMDAARLIF--RPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELA 858
            ++GQ+ A+ +V  AI+R   G  D   P+  F+F+G +G+GKTELAK  A YM  + ++  +R+DMSE+ E+H V++ IG+PPGYVG+EEGGQLT+ +++ P AV+LFDE++KAH DV  + LQ+ D+GR+TD +G+T+   + + IMTSNV S    Q+ L +  E                    K T  +  K+ V+         R EF+ R++E + F P    ++  +V  +L+   KR   R     + D  +  +   GY+ +YGAR +K  +++ V N+LA
Sbjct:  347 IIGQESAIATVGAAIRRKENGWYDEEHPLV-FLFLGSSGIGKTELAKQTAKYMHKDAKKGFIRLDMSEFQERHEVAKFIGSPPGYVGHEEGGQLTKKLKQCPNAVVLFDEVDKAHPDVLTIMLQLFDEGRLTDGKGKTIDCKDAIFIMTSNVASDEIAQHALQLRQEALEMSRNRIAENLGDVQISDKITISKNFKENVIRPILKAHFRRDEFLGRINEIVYFLPFCHSELIQLVNKELNFWAKRAKQRHNITLLWDREVADVLVDGYNVHYGARSIKHEVERRVVNQLA 635          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_BOVIN (Caseinolytic peptidase B protein homolog OS=Bos taurus GN=CLPB PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 8.948e-48
Identity = 105/290 (36.21%), Postives = 168/290 (57.93%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMF-NTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGS----QYILNMDDETF-----------------PKETAYETIKQRVMDAARLIF--RPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELA 858
            ++GQ+ A+ +V  AI+R   G  D   P+  F+F+G +G+GKTELAK  A YM  + ++  +R+DMSE+ E+H V++ IG+PPGY+G+EEGGQLT+ +++ P AV+LFDE++KAH DV  + LQ+ D+GR+TD +G+T+   + + IMTSNV S    Q+ L +  E                    K T  +  K+ V+         R EF+ R++E + F P    ++  +V  +L+   KR   R     + D  +  +   GY+ +YGAR +K  +++ V N+LA
Sbjct:  317 IIGQESAIATVGAAIRRKENGWYDEEHPLV-FLFLGSSGIGKTELAKQTAKYMHKDAKKGFIRLDMSEFQERHEVAKFIGSPPGYIGHEEGGQLTKKLKQCPNAVVLFDEVDKAHPDVLTIMLQLFDEGRLTDGKGKTIDCKDAIFIMTSNVASDEIAQHALQLRQEALEMSRNRIAENLGDVQISDKITISKNFKENVIRPILKAHFRRDEFLGRINEIVYFLPFCHSELIQLVNKELNFWAKRAKQRHNITLLWDREVADVLVEGYNVHYGARSIKHEVERRVVNQLA 605          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_MOUSE (Caseinolytic peptidase B protein homolog OS=Mus musculus GN=Clpb PE=1 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 1.169e-47
Identity = 105/290 (36.21%), Postives = 168/290 (57.93%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMF-NTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGS----QYILNMDDETF-----------------PKETAYETIKQRVMDAARLIF--RPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELA 858
            ++GQ+ A+ +V  AI+R   G  D   P+  F+F+G +G+GKTELAK  A YM  + ++  +R+DMSE+ E+H V++ IG+PPGY+G+EEGGQLT+ +++ P AV+LFDE++KAH DV  + LQ+ D+GR+TD +G+T+   + + IMTSNV S    Q+ L +  E                    K T  +  K+ V+         R EF+ R++E + F P    ++  +V  +L+   KR   R     + D  +  +   GY+ +YGAR +K  +++ V N+LA
Sbjct:  317 IIGQESAIATVGAAIRRKENGWYDEEHPLV-FLFLGSSGIGKTELAKQTAKYMHKDAKKGFIRLDMSEFQERHEVAKFIGSPPGYIGHEEGGQLTKKLKQCPNAVVLFDEVDKAHPDVLTIMLQLFDEGRLTDGKGKTIDCKDAIFIMTSNVASDEIAQHALQLRQEALEMSRNRIAENLGDVQMSDKITISKNFKENVIRPILKAHFRRDEFLGRINEIVYFLPFCHSELIQLVNKELNFWAKRAKQRHNITLLWDREVADVLVDGYNVHYGARSIKHEVERRVVNQLA 605          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_RAT (Caseinolytic peptidase B protein homolog OS=Rattus norvegicus GN=Clpb PE=2 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 3.400e-47
Identity = 104/290 (35.86%), Postives = 167/290 (57.59%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMF-NTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGS----QYILNMDDETF-----------------PKETAYETIKQRVMDAARLIF--RPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELA 858
            ++GQ+ A+ +V  AI+R   G  D   P+  F+F+G +G+GKTELAK  A YM  + ++  +R+DMSE+ E+H V++ IG+PPGY+G+EEGGQLT+ +++ P AV+LFDE++KAH DV  + LQ+ D+GR+TD +G+T+   + + IMTSNV S    Q+ L +  E                    K T  +  K+ ++         R EF+ R++E + F P    ++  +V  +L+   KR   R     + D  +  +   GY+  YGAR +K  +++ V N+LA
Sbjct:  317 IIGQESAIATVGAAIRRKENGWYDEEHPLV-FLFLGSSGIGKTELAKQTAKYMHKDAKKGFIRLDMSEFQERHEVAKFIGSPPGYIGHEEGGQLTKKLKQCPNAVVLFDEVDKAHPDVLTIMLQLFDEGRLTDGKGKTIDCKDAIFIMTSNVASDEIAQHALQLRQEALEMSRNRIAENLGDVQISDKITISKNFKENMIRPILKAHFRRDEFLGRINEIVYFLPFCHSELIQLVNKELNFWAKRAKQRHNITLLWDREVADVLVDGYNVQYGARSIKHEVERRVVNQLA 605          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: AMIB_PSEAE (ATP-dependent protease ATP-binding subunit-like protein amiB OS=Pseudomonas aeruginosa GN=amiB PE=3 SV=2)

HSP 1 Score: 182.956 bits (463), Expect = 3.183e-45
Identity = 102/285 (35.79%), Postives = 171/285 (60.00%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVR-----RRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQG-RTVSFTNTVIIMTSNVGSQYILNMDD--ETFPKETAYETIKQRVMD-----AARLI--FRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGIL 870
            V+GQDPA+++V + ++  RA ++DP RP+ S +F+GPTGVGKTE+ +ALA  +    E   R+DM+   ++H  + L GAPPGYVG +EG  L E  +      RP  ++LFDE+EKA  +V +  L +LD+G +  + G RT  F NT++ MTSN+ +  I   D+  +  P        ++R  D      ARL+  F PEF+NR+D  + F  ++RD ++ +V L++ R+ +R+   + +++ T   +  +   G+D  +GAR ++R ++ ++E  LA+ +L
Sbjct:   61 VLGQDPALQAVEDMLKVVRADIADPRRPLFSALFLGPTGVGKTEIVRALARALHGDAEGFCRVDMNTLSQEHYAAALTGAPPGYVGAKEGTTLLEQDKLDGSPGRP-GIVLFDELEKASPEVVHALLNVLDNGLLRVASGERTYHFRNTLVFMTSNLCAHEIQRYDERRQRLPWRLLPVGGERRRRDIDGMVRARLLKTFSPEFVNRLDSVVTFNWIERDVVARLVELEVQRLNRRLEKHRCRLEATPEVLAKIARAGFDRQFGARALRRSVRHHLEVPLAEHLL 344          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: ADPR_RHOER (ATP-dependent protease ATP-binding subunit-like protein OS=Rhodococcus erythropolis PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 1.478e-42
Identity = 98/284 (34.51%), Postives = 158/284 (55.63%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTE--VVRRRPY--AVILFDEIEKAHSDVFNVFLQILDDGRVTDSQG-RTVSFTNTVIIMTSNVGSQYILN---------MDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGIL 870
            +VGQ  AV +V  AI  +  G +DP RP+A+ + +GPTGVGKTEL + +A+ + +  + L RIDM+   ++H  +   GAPPGY G +E   L +   V   PY   ++LFDE+EKA   V    LQ+LD+G +  + G + +SF N+ + +TSN+GS  +            D     +      + QR ++     F PEF NR+DE ++    D      + RL+++ +  R+A R + ++V D+A+ LL   G+DP YGAR ++R I+  + + +A  +L
Sbjct:   44 IVGQQAAVDAVVRAISIAHVGATDPTRPLANILLVGPTGVGKTELVRRVAAELRSGPDDLCRIDMNALAQEHYAASFSGAPPGYAGSKESFTLFDKNTVEGDPYTPGIVLFDEVEKADPTVLRALLQVLDNGELRLANGQQKISFRNSYVFLTSNLGSAAVAERRRSHLRQLADRVRIDRPRHGHHLVQRALEK---FFDPEFFNRIDETVILDEFDDQTAEQVTRLEIELITTRLARRGIDVEVDDSAVALLQRRGFDPVYGARGLRRTIRNVLADPVAGAVL 324          
The following BLAST results are available for this feature:
BLAST of DC900342 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 200
Match NameE-valueIdentityDescription
CLPA_ECOL68.627e-5944.12ATP-dependent Clp protease ATP-binding subunit clp... [more]
CLPA_ECO578.627e-5944.12ATP-dependent Clp protease ATP-binding subunit clp... [more]
CLPB_YEREN4.734e-5743.43Chaperone protein clpB OS=Yersinia enterocolitica ... [more]
CLPV1_PSEAE4.899e-5440.66Protein clpV1 OS=Pseudomonas aeruginosa GN=clpV1 P... [more]
CLPB_HUMAN8.948e-4836.55Caseinolytic peptidase B protein homolog OS=Homo s... [more]
CLPB_BOVIN8.948e-4836.21Caseinolytic peptidase B protein homolog OS=Bos ta... [more]
CLPB_MOUSE1.169e-4736.21Caseinolytic peptidase B protein homolog OS=Mus mu... [more]
CLPB_RAT3.400e-4735.86Caseinolytic peptidase B protein homolog OS=Rattus... [more]
AMIB_PSEAE3.183e-4535.79ATP-dependent protease ATP-binding subunit-like pr... [more]
ADPR_RHOER1.478e-4234.51ATP-dependent protease ATP-binding subunit-like pr... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900342 VSS Citrus sinensis cDNA clone VS28693 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900342 ID=DC900342|Name=DC900342|organism=Citrus sinensis|type=EST|length=1211bp
AAGCTTCAACAATCAGAGAGGGAGAAGCTGTTACATTTGGAGGAAGAGCT
GCACAAACGTGTTGTGGGTCAAGATCCAGCAGTGAAATCAGTAGCTGAGG
CGATTCAGCGATCTCGAGCAGGTCTTTCTGATCCTCACCGTCCAATAGCT
AGTTTCATGTTCATGGGTCCAACTGGTGTTGGAAAGACTGAACTGGCTAA
GGCACTAGCTTCCTACATGTTCAACACTGAAGAGGCCCTTGTACGAATTG
ATATGAGTGAGTATATGGAAAAGCATGCTGTTTCAAGATTGATTGGAGCC
CCACCTGGTTATGTGGGATATGAGGAAGGAGGACAGTTGACGGAGGTAGT
TCGCCGTAGGCCCTATGCAGTAATTCTGTTCGACGAGATTGAGAAGGCCC
ACTCTGATGTATTTAATGTGTTTCTTCAAATTCTGGATGATGGGAGAGTT
ACTGATTCACAGGGTCGTACTGTGAGTTTCACCAATACTGTCATCATTAT
GACTTCAAACGTGGGTTCACAATACATACTTAATATGGATGATGAGACAT
TCCCGAAGGAGACAGCCTATGAAACTATCAAACAGCGGGTAATGGATGCT
GCAAGATTAATATTCCGCCCCGAGTTCATGAACCGAGTAGATGAGTATAT
AGTATTCCAACCACTGGACCGTGACCAGATAAGCAGTATTGTGAGGTTAC
AGTTGGATCGGGTGCAGAAGAGGATTGCAGACCGGAAGATGAAAATGCAA
GTGACCGATGCAGCTATTCAGCTCCTTGGGAGTCTTGGGTATGACCCCAA
CTATGGTGCAAGGCCGGTCAAGAGGGTGATTCAGCAGTACGTTGAAAATG
AGCTTGCCAAGGGCATTCTGAGAGGGGAGTTCAAGGATGATGACACAATT
GTAACAGACACTGAAGTTACAGCATTTTCCAATGGCCAGCTTCCGCAGCA
AAAGCTAGTCTTCAGGAGACTTGATACCAGTTCGGATGCTTCTGCTGCAG
ATAACCAAGAAGCTTTCTCACAGACAGCATAAATGTCTGTCCAATGTGTT
TAATTTTACGAAATTATATTTGTGTTCAGCAAAATTATGAGCGAATTTTC
TTAACTGATAGGCTGTAACCTGCTTCTTGTATATGATGATGCTTTATACA
AAATCATAAGCCTTGAAGTGTTTCTTTTTCAACGATCATCACAAATTCAC
ATTCGTTTTAT
back to top